KEGG   Sinocyclocheilus anshuiensis: 107703634
Entry
107703634         CDS       T04917                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta-like isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04141  Protein processing in endoplasmic reticulum
sanh04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107703634
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107703634
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sanh03000]
    107703634
Transcription factors [BR:sanh03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107703634
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf YabA DUF4140
Other DBs
NCBI-GeneID: 107703634
NCBI-ProteinID: XP_016361825
UniProt: A0A671N0P6
LinkDB
Position
Unknown
AA seq 689 aa
MMTAELDSRFCADNLLTSEDWDACLYQCEDMEEDFTGELKYDTSLDSDLVLTLDPDNPTS
PWKNLDDNLTGEVPVMKDYNRTITQPLPVDMFFQVKTEPPSPASSLTSDSSISSLPEAQQ
VTVKSENPPTPPYMYGDVLSPPLTSVEVTVTSVSPVHQPPLPLAIQPHALSSLDTQTTVL
SSAATLKASSILSSKPLIQPKPVCVAALPVAQSTSPAKALFLQSVPVPIPAIDQNTTPVV
LSQSVCLGSAPAIVKMEPLSPSMPHCTSPSAPPPSKPIIPASSLTGNSCSDIDMKVLKRQ
QRMIKNRESACQSRKKKKEYLQNLEAQLREAQQENERLRRENQALRLRLAGREATESGSN
KRALCVMALFLFITFTFSPISLKDRTLEAGIEEAAIPLTGRRLLEFERSQELSRKRASER
TTEQKTDRGEEERWRKGELDKKAAVSYQFRNQSDVFSDVKDLLLQDIDRYFSSSDCRQFN
RSESLRLADELRGWVHRHQNNRKSNGKAKVVKKIKIAQQKAQHRKTNFSRYLPIQAHRSI
ESQLQVLPGPEISYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTARPKMSLVMPAM
AINDSVYNSSQGGYEMMMQVDCEVMDTRIIPIKSSVVPPSLRDPPPTPPAHHHHGNHTSL
RSRQQHLHGSGASSRRRAAGYFISQSGSD
NT seq 2070 nt   +upstreamnt  +downstreamnt
atgatgaccgcggagctggacagtcgcttctgcgccgataacctgctaaccagcgaggac
tgggatgcctgtctgtatcagtgtgaggatatggaggaggatttcaccggagaactgaaa
tatgacacatcgctggacagtgatcttgtcctcacgctggaccctgataaccccacatca
ccgtggaagaacctggatgacaacctgacaggtgaagtgccagtcatgaaggattataac
aggactataacacaacctctgccagtggacatgtttttccaggtgaagactgaacctccg
tcacctgcgtcgtctctgacctctgacagctccatctcatctttacccgaagctcagcag
gtgacggtgaagagtgagaacccgcccactccaccgtacatgtatggagacgtgctctcg
ccgccgctgaccagtgtggaggtaaccgtcaccagcgtctctccagtgcatcagcctccc
cttcctctggccatacagccacacgctctcagcagcctcgacacacaaaccacagtcctc
tcctcagcagcgacgctgaaggccagcagcattctgagcagtaaacctctgatccagccc
aaacccgtgtgtgtggccgcgctgccggtggctcagagcaccagtccagccaaagctctc
ttcctgcagagcgttcccgtacccatcccagccatcgaccagaacaccacgcccgtggtt
ctgtctcagtcggtgtgtctgggttctgctcctgctattgttaaaatggagcctttgtct
cccagcatgcctcactgcactagcccctcagccccgcccccgagcaaacccatcatccca
gcatccagcctgactggaaacagctgcagtgacattgacatgaaggttttgaagaggcag
cagcgtatgataaagaaccgggaatcggcctgccagagccgcaagaagaagaaggagtac
ctgcagaacctggaggcgcagctgcgggaggcgcagcaggagaacgaacgcctgcgcaga
gagaaccaagcgctgcggttgcggctcgccgggagagaggctacggagtctggcagcaac
aagagagctctgtgtgtgatggctctgttcctcttcatcacctttaccttcagccccatc
agtctcaaagacaggacattggaagctgggattgaggaagcggctattcctctgacagga
agacgcctgctggagtttgagagatctcaggagctgagcaggaaacgagcaagcgagaga
accacggagcagaagacggacagaggggaggaagaacgctggaggaaaggagagctggac
aagaaggctgcagtctcgtatcagttcaggaatcagagcgatgtgttcagtgatgttaaa
gacctcctccttcaggacatagacagatatttctcgtcctctgactgcagacagttcaac
cgctccgagtccctcaggttggcggatgagctgcgtggatgggtccatcgtcatcagaat
aaccggaagtctaatggaaaggcgaaggttgtgaagaaaattaaaatagctcagcagaaa
gctcagcacagaaagacaaacttttccaggtaccttccaattcaggctcatcgttctatc
gaaagtcagctgcaggtcctgcccgggccagagatcagctacagtgactttctggatgct
attgatcggcgtgaggacactttctacgtcgtatcattcagacgggatcacctgctgtta
cctgccatcagccacaataaaacagctcgacccaaaatgtctctggtcatgcctgccatg
gccatcaatgattcggtgtataactcgtctcagggcggctatgaaatgatgatgcaggtg
gactgtgaggtgatggacacccggatcatcccaatcaagtcctctgtagtcccgccctct
ctcagagacccgccccccactccgcccgctcatcatcaccacggcaaccacacctccctc
cgcagccgacagcagcacttgcatggcagcggggcgtcatcgagacggagggccgcgggt
tacttcatcagccagagcggatccgattga

DBGET integrated database retrieval system