KEGG   Sinocyclocheilus anshuiensis: 107704334Help
Entry
107704334         CDS       T04917                                 

Definition
(RefSeq) methionine aminopeptidase 1D, mitochondrial
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sanh01002]
    107704334
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     107704334
Peptidases [BR:sanh01002]
 Metallo Peptidases
  Family M24
   107704334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M24
Motif
Other DBs
NCBI-GeneID: 107704334
NCBI-ProteinID: XP_016362711
LinkDB All DBs
Position
Unknown
AA seq 338 aa AA seqDB search
MAAPCAAQCFYRTGGSRLLQRVAQLPSCHRSSSAAHQCPPHRCFFWKKSNSSHSVVWPAV
VRPSYAVPKHIQKPDYVSSSKVPEWPDYIEFKDEEQIQGLRRACQLARHILLLAGKSLKV
GMTTDEIDFIVHQEAIRHNAYPSPLHYGGFPKSVCTSVNNVVCHGIPDSRPLQDGDIINI
DVTVYLEGYHGDTSETFLIGSVNEQGRKLVDVARQCRDQAIAACGPGQPLCVIGNTISKV
ANSNGFRVCPYFIGHGIGTYFHGYPEIWHHANDNDLQMEEGMSFTIEPILMEGSSEFKIL
KDKWTAVSVDDKRSAQFEHTVVITSDGVEILTKLPDED
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgccctgtgccgctcaatgcttttacagaacaggtggttcaaggctgctacag
agagtagcacagctgcccagctgccatagaagctcatctgctgcccaccaatgcccacct
caccgatgtttcttctggaagaaatcaaatagttctcacagtgtggtctggcctgctgta
gtgcgtccctcttatgctgtacccaagcacatccagaagccagactatgtgtcatccagc
aaagtgcctgagtggccagattacatagagtttaaagatgaggagcagatccagggattg
agacgagcatgtcaactagccagacacatactgctcctggcaggaaagagtttgaaggtt
ggtatgacgaccgatgaaatagactttatagtccatcaggaagccattcgtcacaatgcc
tacccctctcctttacattacgggggctttccgaagtcagtctgcacctctgttaacaat
gtagtatgccatggcattccagacagtcggccattgcaggatggagatatcatcaatata
gatgtcacagtttatctagaaggttaccacggagacacctcagaaacatttctgattggc
tcagtgaatgaacagggcaggaagttagtggatgtggctcgacagtgcagagatcaggcc
attgccgcctgtggaccaggtcaacctctgtgcgtcattggcaacactatcagcaaagta
gcaaattcaaatggattccgtgtgtgtccatattttatcggtcatgggatcggaacatat
ttccatggttatccagagatatggcatcatgccaatgacaatgacctacagatggaagag
ggcatgtccttcaccatagaacccattcttatggaaggatcctcagaattcaagatcctg
aaggacaagtggactgctgtatctgtggatgacaaaagatcggcccaatttgaacacacg
gttgtaatcaccagcgatggtgtagagattctgacaaaactaccagatgaagattga

DBGET integrated database retrieval system