KEGG   Sinocyclocheilus anshuiensis: 107704409Help
Entry
107704409         CDS       T04917                                 

Definition
(RefSeq) transmembrane protease serine 9-like
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sanh01002]
    107704409
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     107704409
Peptidases [BR:sanh01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107704409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 SEA Ldl_recept_a DUF1922
Motif
Other DBs
NCBI-GeneID: 107704409
NCBI-ProteinID: XP_016362815
LinkDB All DBs
Position
Unknown
AA seq 787 aa AA seqDB search
MEKKDLNKWPEGDPRPAYLSTCKCMTLAAILILLIIGAAVGFMTAFLIQEEHYFMETVEL
QGLSYDPDLRDKTSGFYVVLTATLKEKIRNIFSTSAVARHFTDCQIVAYGNANTNVLTTL
RLVFRISQVQGYTESFVQDLLRTGLKAMLNGKPIVVPDYGEISSIILLGASGKSFYEIGN
DISKCPEETFTCDNGECITKLNPECDFITDCVDGSDEAFCSCGTRPAMANRVVGGENARH
GEFPWQVSLRLRGHHTCGASIVNNRWLVSAAHCFEIENDPKDWTALVGANLVSGEQDEAT
TVNIKSLVLSPSYDPMTTDSDVTVLELETPLTFSPYVQPVCIPSSSHIFSAGQNCIVSGW
GALNQYTSEYPSTLQKAIVKIIDSKVCNKSSVYRGELTQNMMCAGFLQGKVDSCKGDSGG
PLVCEVSPGRFFLAGVVSWGVGCAQINKPGVYSRVTKLRNWILSYTNTAPTIQVGPTVPS
ITTTALHISKSINPSTEHVNNDYNPTPGNCSANYNCGGDMCISKTNPECDRVSDCPNDAD
EKNCDCGNRPVIGQERIIGGVTAHRGEWPWVGSLQYQRTHRCGATLIHCKWLLTAAHCFR
GDLNPSSWTVSLGSVIWSGVGALVIPVQRIIPHPAFNSSTMDFDVALVEISIPTPKSYTI
QTVCLPSPWHIFNKNMECYITGWGAVREGGMITSLLQKAQVSIIDQLDCQQAYGAELTNM
MCAGSMEGDRDTCLGDSGGPLVCHEPQGRWFLAGVTSWGHGCGRLGFPGVYMQVTAVREW
ISTYLPL
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaagacttgaataagtggcccgagggtgatccacggccagcttacctctcc
acttgcaaatgtatgactttagctgccatattgattcttctcatcattggggctgctgtg
ggttttatgacagctttcttaatacaagaggaacattatttcatggagacagtggaattg
caagggctcagttatgatccagatctgcgtgataaaacatcaggattctatgtagtcctg
actgcaactctgaaagaaaagatcaggaatatctttagcacctctgcagtagcaagacac
tttactgactgccagatagttgcatatgggaatgccaacacaaatgttttgacaactcta
cgtttggtcttccggatctctcaagtgcaggggtatacagagagttttgttcaagacctc
ctccgcactggattgaaggccatgctgaatgggaaacccatcgttgtcccagattacgga
gagatcagtagcatcatccttcttggggcaagtggaaaatcattctatgagattgggaat
gacataagtaaatgtcctgaagaaacattcacttgtgacaacggcgaatgcatcacaaag
ctaaatccagaatgcgactttataaccgactgtgttgatggttcagatgaagccttttgc
tcctgtggaacacgtccagccatggctaaccgtgttgtgggtggtgaaaacgcccgtcat
ggggagtttccctggcaggtcagtctcagactgcgtggccatcatacctgtggtgcatcc
atcgtcaacaatcgctggctcgtcagcgctgcccattgttttgaaatagaaaacgatcca
aaagattggacagctcttgtgggagccaatctagtcagtggagagcaggacgaagccacc
acagtaaacatcaagtccctggttctctctccaagctacgatcccatgaccactgacagt
gatgtgactgtgctggagttggaaacgcccttgacgttcagcccttatgttcagccagtc
tgtatcccatcatcctctcacattttcagtgctgggcagaactgcatcgtctctggctgg
ggggctcttaatcagtacaccagtgagtatccttctacattacagaaggcaattgtgaag
atcattgactcgaaagtttgcaacaagtcatctgtatacagaggtgaacttacccaaaat
atgatgtgtgctggttttcttcaagggaaggtggactcttgtaagggagattctggaggc
cctctggtatgtgaggtgtcccctggacgctttttcttggctggcgtggtgagctgggga
gtgggttgtgcacagatcaacaagcctggggtctattcccgcgtcaccaagctccgcaac
tggattctgagctacaccaatactgcaccaacaatccaagttggccccacagtccctagc
atcacaaccactgcgcttcacatcagtaaatctataaacccatccactgagcatgtcaat
aatgattataaccctactcctgggaactgcagtgctaattacaactgtggcggagacatg
tgcatcagcaagacaaacccagagtgtgacagagtcagtgactgccccaatgatgcagat
gagaaaaactgtgactgtgggaatcggccagtcatcggccaggagaggattattggtggc
gtcaccgcccatagaggtgaatggccgtgggtgggcagtctgcagtaccaacgcactcac
cgctgtggagctacacttatccactgcaaatggctcctgaccgcagctcactgcttcaga
ggtgacctgaacccttccagctggacggtaagtctcggctcggtcatttggtctggagtg
ggtgctctggtgattccagtgcaaaggatcatccctcatcctgctttcaacagcagcacc
atggacttcgatgtggccctggttgaaatctccatccccactccaaagtcctacaccatc
cagactgtgtgtttgccttctccctggcatatcttcaacaaaaatatggaatgctacatc
actggatggggtgctgtgagggagggtggtatgataaccagtttgctgcaaaaagcacag
gttagtatcattgatcagttggactgccagcaagcttacggggctgaacttaccaacatg
atgtgtgctggctctatggaaggagacagggacacatgtttgggagactcagggggccct
ctggtgtgccatgaaccccagggccggtggtttctggctggggtgaccagctggggtcac
ggttgtggtcgacttggcttcccaggagtttacatgcaagtcacggctgtcagagaatgg
atatctacatacctccctttataa

DBGET integrated database retrieval system