KEGG   Streptococcus anginosus SA1: DK43_02360Help
Entry
DK43_02360        CDS       T03658                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sans  Streptococcus anginosus SA1
Pathway
sans00220  Arginine biosynthesis
sans00250  Alanine, aspartate and glutamate metabolism
sans00290  Valine, leucine and isoleucine biosynthesis
sans01100  Metabolic pathways
sans01110  Biosynthesis of secondary metabolites
sans01130  Biosynthesis of antibiotics
sans01210  2-Oxocarboxylic acid metabolism
sans01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sans00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DK43_02360
   00290 Valine, leucine and isoleucine biosynthesis
    DK43_02360
   00220 Arginine biosynthesis
    DK43_02360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sans01007]
    DK43_02360
Enzymes [BR:sans01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     DK43_02360
    2.6.1.66  valine---pyruvate transaminase
     DK43_02360
Amino acid related enzymes [BR:sans01007]
 Aminotransferase (transaminase)
  Class I
   DK43_02360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase MHC_II_alpha
Motif
Other DBs
NCBI-ProteinID: AIK77220
UniProt: A0A2T0FZN4
LinkDB All DBs
Position
470757..471971
Genome map
AA seq 404 aa AA seqDB search
MKEFNKSTKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKNIPNVDIDDVYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYLCDEAADWYPDIDDIRSKITSNTKAIVVINPNNP
TGALYPKEVLEELVEVARQNNLIIFADEIYDRLVMDGEKHTAIASLAPDLFCVSMNGLSK
SHRIAGFRVGWMVLSGPKYHVKDYIEGLNMLSNMRLCSNVLSQHVVQTSLGGYQSVDELL
LPGGRIYEQRNFIYKAINEIPGLSATKPKAGLYIFPKIDREMYRVDDDEQFVLDFLKQEK
ILLVHGRGFNWKDPDHFRIVYLPRVDELAQIQEKMTRFLRQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatttaataaatcaacaaaattagaacatgtggcttatgatattcgtggtcct
gtcttagaagaagccatgaggatgcgcgcaaacggtgagaaaatcctccgtttgaataca
ggaaacccagctgagtttggttttacagcgccagatgaggtgattcatgacttgattatg
aatgcacgtgatagcgaggggtattctgactcgaaagggattttttctgctcggaaagct
attatgcaatattgccagttaaagaatattccaaatgttgatattgacgatgtctacctt
ggaaatggagtcagcgagctgattgtcatgtctatgcaaggtttgctagacaatggcgat
gaggtattggttccgatgccggattatccactctggaccgcagcggtcagtttagcagga
gggaatgcagttcattatctttgtgatgaagctgctgattggtacccagatattgatgac
attagatcgaaaattacttctaatacaaaggctattgtcgttatcaaccccaacaatccg
acaggagctttgtatcctaaagaggtgttggaagaacttgttgaagttgcgcggcaaaac
aacttgattatttttgcagatgagatttatgaccgtttagtgatggacggtgagaaacat
acggctatcgccagtttggctcctgacctcttttgtgtcagcatgaacggcttgtctaaa
tcacaccgtatcgcgggttttcgtgtcgggtggatggtgttatctggtcctaaatatcac
gtgaaagattatattgaagggctaaacatgctatccaatatgcgtttgtgctcaaacgtc
ttatctcagcatgtggtacaaacgtcgcttggtggttatcaatcagttgatgaattgctg
cttcctggtgggcgcatttatgagcaacgaaactttatttacaaggctatcaatgaaatt
ccaggcttgtcggcaacaaaacctaaagctggtctttatatttttcctaaaattgatagg
gaaatgtatcgagtagatgacgatgagcaattcgtgcttgatttcttaaagcaagaaaag
attttgctggtgcacggacgaggctttaactggaaagatccagatcatttccggattgtt
tatctgcctcgtgtagatgaactggcacaaattcaagaaaagatgactcgtttcctaaga
caataccggagatga

DBGET integrated database retrieval system