KEGG   Streptococcus anginosus SA1: DK43_05160Help
Entry
DK43_05160        CDS       T03658                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sans  Streptococcus anginosus SA1
Pathway
sans00500  Starch and sucrose metabolism
sans01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sans00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DK43_05160
Enzymes [BR:sans01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     DK43_05160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AIK77735
LinkDB All DBs
Position
complement(1036565..1038013)
Genome map
AA seq 482 aa AA seqDB search
MKNQTLMQYFEWYLPNDGQHWNRLATDAPHLASKGIRKVWMPPAFKATSSNDVGYGIYDL
FDLGEFDQKGTVRTKYGFKKDYLKAISALKENGIEPIADIVLNHKAAADYKERFTVIEVD
PNDRTVALSEPFEIKGWTKFTFPGRHKKYNDFEWHWYHFTGTDYDAKRNKSGIYLIQGDN
KGWADDDLVDNENGNFDYLMYADLDFKHPEVIQNLYDWADWFIETTGIHGFRLDAIKHID
SFFMGNFIRDIMAKYGEDFYVFGEFWNGDETANNDYLGSIDYRFDLVDVKLHHNLFDASR
AGADYDLRNIFEQTLVKNHPKSAVTFVDNHDTQRGQALESTVEEWFKPAAYALILLREAG
LPCVFYGDYYGINGKFAQQSFQEVLDKLLDIRLNLAYGEQTDYFDDEHCIAWTRSGKDNE
QPIAVIISNDQANAKRMYVGENWAGKAFKDYLGNCSESVTIKKDGWADFPVAEKSVSVWS
VQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaaacattaatgcaatattttgaatggtatctaccaaatgacgggcaacat
tggaatcgtttggctacagacgctccacatctagcttctaaaggcattcgcaaggtttgg
atgccacctgctttcaaagcaactagttctaatgatgtcggctacggcatttatgactta
tttgacttgggcgaatttgaccaaaaaggaaccgttcggacaaagtatggctttaagaaa
gactatttgaaggctatctcagcactcaaagaaaatgggattgagcccattgcagatatc
gttttaaatcacaaggcggcagcagattacaaagagagatttactgttattgaagttgac
ccaaatgatcgtacagtcgccctctctgaaccttttgaaataaaaggctggaccaagttc
acattccctggtcgccataaaaaatacaatgattttgaatggcattggtaccactttaca
ggaacggattatgacgctaagcgaaataaatcagggatttacctcattcaaggggacaac
aaaggttgggctgatgatgacttagtagacaatgaaaatggaaatttcgactatcttatg
tacgctgaccttgattttaagcacccagaagtcattcaaaacctttatgattgggcagat
tggtttatcgaaacgaccggcattcatggctttagattggacgctattaagcatattgac
tctttctttatgggaaattttatccgcgacattatggcgaagtatggagaagatttctat
gtcttcggagagttttggaatggtgatgaaactgcaaataacgattatttaggaagtatt
gactatcgttttgatctcgtagatgtcaaactgcaccacaacttatttgatgctagccgt
gctggggcggactatgatttgcgaaatatttttgaacaaacgcttgtcaaaaaccaccct
aaatcggctgttacttttgtcgataatcacgacacacaacgtggacaagcgctagaatca
actgttgaagaatggtttaaacctgctgcttatgcgcttattttgcttcgtgaagctggg
cttccttgtgtgttctacggagattactatggcatcaacggcaagttcgctcaacaaagt
ttccaagaagtcctagataaactgttagacattcggctcaacttagcctatggagaacag
actgattattttgatgacgagcattgtatcgcttggactcgttcaggaaaggacaacgaa
caaccaattgctgttatcataagtaacgaccaagcaaatgcaaaacgcatgtatgttggt
gaaaattgggctggtaaggcgttcaaagattacttgggaaattgctcagaaagcgtgaca
atcaaaaaagacggctgggcagatttcccagttgcagaaaagtcagttagtgtctggtct
gtgcaataa

DBGET integrated database retrieval system