KEGG   Streptococcus anginosus SA1: DK43_05530Help
Entry
DK43_05530        CDS       T03658                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sans  Streptococcus anginosus SA1
Pathway
sans00010  Glycolysis / Gluconeogenesis
sans00020  Citrate cycle (TCA cycle)
sans00620  Pyruvate metabolism
sans01100  Metabolic pathways
sans01110  Biosynthesis of secondary metabolites
sans01120  Microbial metabolism in diverse environments
sans01130  Biosynthesis of antibiotics
sans01200  Carbon metabolism
Module
sans_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sans00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DK43_05530
   00020 Citrate cycle (TCA cycle)
    DK43_05530
   00620 Pyruvate metabolism
    DK43_05530
Enzymes [BR:sans01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DK43_05530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding CAT
Motif
Other DBs
NCBI-ProteinID: AIK77805
LinkDB All DBs
Position
1108939..1109982
Genome map
AA seq 347 aa AA seqDB search
MTDDKLRATPAARKLADDLGINLYDVSGTGAKGRVHKEDIESYREFNIVKITPLAKRIAE
ENNIAWQEIQGTGIRGKIMKKDVLTLLPENVDSDSIKSPAQIEKAEEIPDNITPYGEIER
LPMTPMRKVIAKRMVDSYLTAPTFTLNYDVDMTELLALRKKVLEPIMEATGKKITVTDLL
SMAVVKTLMKHPYLNSSLTEDGQIIIMHNYVNLAMAVGMDNGLMTPVVYNAEKMSLSELV
VAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGPIINQPNSAILGVSSTIEKPV
VVNEEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKALIEDPISMLV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgactgatgataagttaagagcgacccctgctgctagaaaattagcagatgacttgggt
atcaatctctatgacgtatctggtactggcgcaaagggacgagttcataaagaagatatc
gaaagttatcgagaattcaatattgtgaaaattacgccccttgcaaaacgtattgcagaa
gaaaataatatcgcttggcaggaaatccaagggacaggtattcgcggcaagattatgaag
aaggacgttctgactttgcttcctgaaaatgttgactcagacagcatcaagtcacctgct
cagattgagaaagcggaagaaatacctgacaacatcactccttatggagaaattgaacgc
cttccaatgacgccaatgcggaaggtcattgcaaaacgaatggtggattcttatctgaca
gcgccaacttttactctcaactatgatgtagatatgacagaactgttggcgctacgcaaa
aaggttttagagccaatcatggaagcgacaggaaagaaaatcacggtcacggatttactt
tctatggctgttgtcaaaactttgatgaagcacccttatctcaattcgtctctgacagaa
gatgggcaaatcattatcatgcacaattatgtcaatctggctatggctgttggtatggac
aacgggcttatgacaccggtggtttacaatgccgaaaaaatgagtctgtctgagttagtc
gttgccttcaaggatgtgattggtcggactttagacgggaaattagcgccaagtgaattg
caaaactcaacttttacgattagcaatctaggaatgtttggtgttcaatctttcggacca
attatcaatcagcccaattctgcgattttgggagttagctcaaccattgaaaaaccagtc
gtagtaaacgaagaaattgtgattcgaccaatcatgagtcttggattaaccattgaccac
cgagtcgtggacggcatggcaggtgctaaattcatgaaagacctgaaagcactaattgaa
gacccgatttcaatgttggtataa

DBGET integrated database retrieval system