KEGG   Streptococcus anginosus SA1: DK43_05620Help
Entry
DK43_05620        CDS       T03658                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sans  Streptococcus anginosus SA1
Pathway
sans00240  Pyrimidine metabolism
sans01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sans00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    DK43_05620
Enzymes [BR:sans01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     DK43_05620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 AAA_22 KdpD AAA_30 DUF4371 ATPase_2
Motif
Other DBs
NCBI-ProteinID: AIK77822
LinkDB All DBs
Position
complement(1126983..1127567)
Genome map
AA seq 194 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKGVVIMTSALDTRDGFGVVSSRIGMKRKAV
AIAEDTDIFRFIQEMPEKPYCVLIDEAQFLSRHHVYDLARVVDELNVPVMAFGLKNDFRN
ELFEGSKYLLLLADKIDEIKTICQFCSKKATMVLRTTNGKPVYEGEQIQIGGNETYIPVC
RKHYFQPEIDEMKS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctcagttgtattataaatatggcacgatgaactcgggcaaaacaatcgaaatttta
aaagtagcacacaactatgaagaacagggcaaaggtgttgttatcatgacgagcgcactt
gatacacgtgacggtttcggcgttgtttctagtcgtattggcatgaagcgaaaagcagtt
gcaatagcagaagatactgatattttccgctttattcaagaaatgcctgaaaagccttat
tgcgtattgattgatgaagctcagtttctttctcgtcatcatgtctatgatttggcaaga
gtagttgatgaattaaatgtaccagttatggcttttggtttgaaaaatgattttcgcaat
gagttatttgaaggctccaaatatctcctgcttctagcagataaaattgatgagattaaa
acgatttgtcaattttgctccaaaaaagcaaccatggtattaagaacaacgaatggtaag
ccggtctatgaaggggagcagattcaaatcggtgggaatgaaacatatattcctgtctgt
cggaagcattattttcagccagaaattgacgaaatgaagagttaa

DBGET integrated database retrieval system