KEGG   Streptococcus anginosus SA1: DK43_05895Help
Entry
DK43_05895        CDS       T03658                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
sans  Streptococcus anginosus SA1
Pathway
sans03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sans00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    DK43_05895
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sans03400]
    DK43_05895
Enzymes [BR:sans01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     DK43_05895
DNA repair and recombination proteins [BR:sans03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     DK43_05895
 Prokaryotic type
     DK43_05895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AIK77876
UniProt: A0A418G7Q4
LinkDB All DBs
Position
complement(1183237..1183890)
Genome map
AA seq 217 aa AA seqDB search
MGHSAWHSLIKQQLPDGYFGKINYFLNQVYSSGTIYPPREKVFNAIQTTDLADVKVVILG
QDPYHGPRQAQGLSFSVPDDIPAPPSLQNILKELADDIGIKESHDLTPWARQGVLLLNAS
LTVPAGQANGHAGQIWEPFTDAVIKVVNEKDTPVVFILWGSYARKKKALITNPRHLILES
PHPSPLSAHRGFFGSKPFSKTNAFLTSQGIEPINWLL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgggacattcagcttggcatagtttgattaagcagcagttgcctgacggctattttggt
aaaatcaattactttttaaatcaagtttattcatcaggtacaatctatccaccgcgtgaa
aaagtttttaatgcgattcagacgacggatttagcagatgtaaaagtagtgattttgggg
caagatccctatcatggtccgcgtcaagcgcaggggctgagcttttcagtaccagatgat
attccagcaccgccttctcttcaaaatattttgaaagagttagcagatgacattggcatc
aaagaatctcatgatttgacaccttgggcacggcaaggagtcttgctgctgaatgccagt
ttgaccgttcctgctgggcaagcaaatggacatgccggtcaaatctgggaaccgtttacg
gatgctgtgattaaggttgtcaatgaaaaagatacacctgttgtctttatactctggggc
tcttatgcacgcaagaaaaaagccttgatcactaatcctagacatctcattttagaatct
cctcatccaagccctctctcagctcatcgtggattttttggtagcaaacctttttctaaa
acaaatgcctttctaacgtctcaagggatagaaccgataaattggttattgtaa

DBGET integrated database retrieval system