KEGG   Streptococcus anginosus SA1: DK43_08235Help
Entry
DK43_08235        CDS       T03658                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sans  Streptococcus anginosus SA1
Brite
KEGG Orthology (KO) [BR:sans00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DK43_08235
Enzymes [BR:sans01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DK43_08235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C FAD_binding_3 DAO Thi4 FMO-like Glutaredoxin Ribosomal_L21p NAD_binding_8 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AIK78323
LinkDB All DBs
Position
complement(1671527..1673059)
Genome map
AA seq 510 aa AA seqDB search
MALDETIKAQLKQYLELLESDVVFQASLGQDERSEQVRAFLEEIVAMSPRLSLENTETNR
KPSFIVTQVGQAGRVQFAGLPLGHEFTSFVLALLQVSGRAPKVEDAVVNRIQAIKQSLHF
ETYVSLTCHNCPDVVQALNVMAILNPNISHTMVEGGMFRQEVEDKKIMAVPTVFLNGEEF
ANGRMTIEQLLDKISGPASSEEFDKKEPFDVLVVGGGPAGSSAAIYAARKGIRTGMVVET
FGGQVMETVGIENMIGTPYTEGPKLMAQVEEHAKKYPIDIMKNQRVKNIEKKELIEVELE
NGAVLKAKTAVLSVGARWRNVNVPGEEEFRTKGVTNCPHCDGPIFTGKKVAVIGGGNSGI
EAAIDLAGLAEHVYVLEFLPTLKADQVLQDRVHQLENVTVLTNVATKEIQGSDQVEAITY
LNRANNEEHKIELSGVFVQIGLLPNTDWLKDSSVALNERGEIIVDKHGATNVPGIFAAGD
CTDSAYKQIIISMGSGATAALGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggctttagatgaaacaattaaagcacaactgaagcaatacttggaacttttagaatct
gatgttgtatttcaagcgtctttaggtcaagatgagcgttctgagcaggtgcgggctttt
ctagaggaaattgtagcaatgtctccacgtttatcactagaaaatacagaaactaaccgt
aaaccaagttttatcgtgacacaagttggtcaagcaggtcgtgttcaatttgcaggtctt
cccttggggcatgaatttacatcttttgtgcttgctttgctacaagtctctggtcgcgca
ccaaaagtagaagatgctgttgtaaaccgaattcaagctattaagcaatcacttcatttt
gaaacttatgtcagcttaacctgtcataattgcccagacgttgtgcaagctctcaatgtg
atggctattttgaatcctaatatcagccacacaatggtcgaaggaggcatgtttagacaa
gaagttgaagacaaaaagatcatggctgttccaacggtttttctaaatggtgaagaattt
gcaaatggtcgtatgaccattgagcaactgcttgataagatttctggacctgcttcaagt
gaagaatttgacaaaaaagaaccatttgatgtgttggttgttgggggcggacctgcagga
agcagcgcagctatttatgctgctcgtaagggaattcgtacaggtatggtcgttgaaact
ttcggtggacaggtgatggagaccgttggtattgaaaatatgattggaactccctataca
gaaggacctaagctgatggcgcaagtagaagaacatgccaagaaatatccaattgatatc
atgaagaatcaacgtgtgaagaacattgagaaaaaggaattgattgaagtggaacttgaa
aatggagctgttctgaaagcgaaaacggcagttctttctgttggtgctcgctggagaaat
gttaatgttcctggtgaagaagaattccgaacaaaaggtgtaaccaattgtccacattgt
gacggtcctatttttacaggtaaaaaagtagctgttatcggtggaggaaattctggtatt
gaagcagcgattgacttggctggtctggcagagcatgtttatgtgttagaatttctacca
actttgaaagccgatcaagtattgcaagatcgggtacaccaacttgaaaacgtgacggtt
ctaaccaatgtagcaacaaaagaaattcaaggttctgatcaagtggaagccattacttat
ctcaatcgtgcgaacaatgaagaacataaaatcgaactcagcggtgtctttgttcaaatt
ggtcttttaccaaatacagactggctcaaagatagttcagttgctctcaatgaacgtggt
gaaattattgttgacaaacatggtgcaacaaatgttccaggaatttttgcggcaggtgat
tgtactgatagtgcttataagcaaatcattatttcaatggggtcaggagcgacagcagct
ttgggagcgtttgattacttaattcgtcaataa

DBGET integrated database retrieval system