KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00219Help
Entry
SAOUHSC_00219     CDS       T00324                                 

Definition
(RefSeq) hypothetical protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00040  Pentose and glucuronate interconversions
sao00051  Fructose and mannose metabolism
sao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAOUHSC_00219
   00051 Fructose and mannose metabolism
    SAOUHSC_00219
Enzymes [BR:sao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SAOUHSC_00219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 PrmA Methyltransf_25 2-Hacid_dh_C Methyltransf_31 UDPG_MGDP_dh_N DUF4179
Motif
Other DBs
NCBI-GeneID: 3920295
NCBI-ProteinID: YP_498814
UniProt: Q2G2C5
LinkDB All DBs
Position
238356..239399
Genome map
AA seq 347 aa AA seqDB search
MKALKLYGVEDLRYEDNEKPVIESANDVIIKVRATGICGSDTSRYKKMGPYIKGMPFGHE
FSGVVDAIGSDVTHVNVGDKVTGCPAIPCYQCEYCLKGEYARCEKLFVIGSYEPGSFAEY
VKLPAQNVLKVPDNVDYIEAAMVEPSAVVAHGFYKSNIQPGMTVAVMGCGSIGLLAIQWA
RIFGAAHIIAIDIDAHKLDIATSLGAHQTINSKEENLEKFIENHYANQIDLAIESSGAKV
TIGQILTLPKKGGEVVLLGIPYDDIEIDRVHFEKILRNELTVCGSWNCLSSNFPGKEWTA
TLHYMKTKDINVKPIISHFLPLEKGPETFDKLVNKKERFDKVMFTIY
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcattgaaattatatggcgtggaagatttacggtatgaggataatgaaaagcca
gtcattgaaagtgcgaatgacgttattattaaagtacgagcgactggcatatgtggttca
gacacgtcacgatacaaaaaaatggggccatacattaaaggtatgccatttggtcatgaa
ttttcaggtgtagtagatgccattggaagtgatgttacgcatgttaatgtgggcgacaaa
gtgacaggttgcccagcaataccttgttatcaatgcgagtattgtttaaaaggtgaatat
gcacgatgtgaaaagttattcgtcattggctcatatgaacctggatcgttcgcggaatat
gtcaaattgccagcgcaaaatgttttaaaggttccagacaatgttgattacattgaagca
gcaatggttgagccatcagccgttgttgcgcatgggttttataaatcgaatatacaacct
ggtatgactgttgcagtaatggggtgtggcagtataggtttgttagctattcaatgggca
cgaatatttggtgctgcacatatcatcgctatagatatagatgcgcataaactagatatt
gcaacatcattgggcgcacatcaaacaatcaattcaaaagaagaaaatcttgagaaattc
atcgaaaatcattacgccaatcaaatcgatttagctatagaatcatcaggtgctaaagtt
acgattggtcaaatattgacgctacctaaaaaaggtggcgaggtggtattactcggaata
ccatatgatgatattgagattgatcgcgttcattttgaaaaaattctgcgtaacgagttg
acagtatgtggctcttggaactgtttgtccagtaattttccgggcaaagagtggacggca
accttacattatatgaagacgaaagatattaatgtaaagcctattatttctcatttttta
ccgttagaaaaaggcccggagacatttgataaattagttaacaagaaagaacgatttgat
aaagtcatgtttacgatttattag

DBGET integrated database retrieval system