KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01597Help
Entry
SAOUHSC_01597     CDS       T00324                                 

Definition
(RefSeq) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00330  Arginine and proline metabolism
sao01100  Metabolic pathways
sao01110  Biosynthesis of secondary metabolites
sao01130  Biosynthesis of antibiotics
sao01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAOUHSC_01597
Enzymes [BR:sao01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     SAOUHSC_01597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored PDH DUF4918 NAD_Gly3P_dh_N ApbA
Motif
Other DBs
NCBI-GeneID: 3920013
NCBI-ProteinID: YP_500112
UniProt: Q2FY68
LinkDB All DBs
Position
1521425..1522210
Genome map
AA seq 261 aa AA seqDB search
MAQAIFTGIINSSNLDANDIYLTNKSNEQALKAFAEKLGVNYSYDDATLLKDADYVFLGT
KPHDFDALATRIKPHITKDNCFISIMAGIPIDYIKQQLECQNPVARIMPNTNAQVGHSVT
GISFSNNFDPKSKDEINDLVKAFGSVIEVSEDHLHQVTAITGSGPAFLYHVFEQYVKAGT
KLGLEKEQVEESIRNLIIGTSKMIERSDLSMAQLRKNITSKGGTTQAGLDTLSQYDLVSI
FEDCLNAAVDRSIELSNIEDQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagctatatttacaggaattattaactcaagcaacttagatgccaatgatata
tatttaacaaataaatctaatgaacaagctttaaaagcattcgctgaaaaactaggtgtt
aactatagttatgatgatgcgacattattaaaagatgcagattatgtatttttaggtacc
aaaccacatgactttgatgctctagcaacacgcatcaaaccacatattacaaaagacaat
tgcttcatttcaattatggcaggtattccgattgattatattaaacaacaattagaatgc
caaaatccagttgctagaattatgccaaacacaaatgcgcaagttggacactctgttact
ggcattagtttttcaaacaactttgaccctaaatctaaagatgaaattaacgatttagtt
aaagcatttggttctgtaattgaagtatcagaagatcatttacatcaagtaacagctatc
accggaagcggcccagcatttttatatcatgtattcgagcaatatgttaaagctggtacg
aaacttggtctagaaaaagaacaagttgaagaatctatacgcaaccttattataggtaca
agtaagatgattgaacgttcagatttgagcatggctcaattaagaaaaaatattacctct
aaaggtggtacgacacaagctggccttgatacattgtcacaatatgatttagtatctatt
ttcgaagattgtctaaacgctgccgtcgaccgtagtattgaactttctaatatagaagac
caataa

DBGET integrated database retrieval system