KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01623Help
Entry
SAOUHSC_01623     CDS       T00324                                 

Definition
(RefSeq) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00061  Fatty acid biosynthesis
sao00620  Pyruvate metabolism
sao00640  Propanoate metabolism
sao01100  Metabolic pathways
sao01110  Biosynthesis of secondary metabolites
sao01120  Microbial metabolism in diverse environments
sao01130  Biosynthesis of antibiotics
sao01200  Carbon metabolism
sao01212  Fatty acid metabolism
Module
sao_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAOUHSC_01623
   00640 Propanoate metabolism
    SAOUHSC_01623
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SAOUHSC_01623
Enzymes [BR:sao01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SAOUHSC_01623
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SAOUHSC_01623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK ATPgrasp_ST GARS_A Oxidored_nitro ATPgrasp_Ter ATP-grasp_4
Motif
Other DBs
NCBI-GeneID: 3919961
NCBI-ProteinID: YP_500137
UniProt: Q2FY43
LinkDB All DBs
Structure
PDB: 

Position
complement(1545328..1546683)
Genome map
AA seq 451 aa AA seqDB search
MKKVLIANRGEIAVRIIRACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYL
NIPNILSIATSTGCDGVHPGYGFLAENADFAELCEACQLKFIGPSYQSIQKMGIKDVAKA
EMIKANVPVVPGSDGLMKDVSEAKKIAKKIGYPVIIKATAGGGGKGIRVARDEKELETGF
RMTEQEAQTAFGNGGLYMEKFIENFRHIEIQIVGDSYGNVIHLGERDCTIQRRMQKLVEE
APSPILDDETRREMGNAAVRAAKAVNYENAGTIEFIYDLNDNKFYFMEMNTRIQVEHPVT
EMVTGIDLVKLQLQVAMGDVLPYKQEDIKLTGHAIEFRINAENPYKNFMPSPGKIEQYLA
PGGYGVRIESACYTNYTIPPYYDSMVAKLIIHEPTRDEAIMAGIRALSEFVVLGIDTTIP
FHIKLLNNDIFRSGKFNTNFLEQNSIMNDEG
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggttttaattgcaaaccgcggtgaaatcgcagttaggattattcgcgcttgt
cgtgatttaggcatccaaactgttgcaatctattctgaaggggataaagatgcgctacat
actcaaattgctgatgaagcatattgcgtaggtcccactttgtctaaagattcatattta
aatattccgaacatcttatctattgcaacttctacaggttgtgatggcgttcatccgggt
tatggctttttagctgaaaatgctgattttgcagaattatgcgaagcatgccaattgaag
ttcattggaccaagttatcaatctatccaaaaaatgggtatcaaagatgttgctaaggca
gaaatgatcaaagccaatgttccagttgttcctggtagtgacggtttaatgaaagacgtc
tcagaagctaagaaaatcgccaaaaaaattggctatccggtcatcattaaagctactgct
ggcggtggcggaaaaggtatccgtgttgctcgtgatgaaaaagaacttgaaactggcttc
cgaatgacagaacaagaagctcaaactgcatttggtaatggtggactttatatggagaaa
ttcatcgaaaacttccgccatattgaaatccaaattgttggggacagctatggtaatgta
attcatttaggagaacgtgattgtacaattcaaagacgtatgcagaaattagtggaagaa
gcaccttccccaattttagatgatgaaacacgtcgtgaaatgggaaatgccgcagttcgt
gcagcgaaagctgtaaattatgaaaatgcgggaacaattgagtttatatatgatttaaat
gataataaattttattttatggaaatgaatacacgtattcaagtagaacatcctgtaact
gaaatggtaacaggaattgatttagttaaattacaattacaagttgctatgggtgacgtg
ttaccgtataaacaagaagatattaaattaacaggacacgcaattgaatttagaattaat
gctgaaaatccttacaagaactttatgccatcaccaggtaaaattgagcaatatcttgca
ccaggtggatatggtgttcgaatagagtcagcatgttatactaattatacgataccgcca
tattatgattcgatggtagcgaaattaatcatacatgaaccgacacgagatgaagcgatt
atggctggcattcgtgcactaagtgaatttgtggttcttggtattgatacaactattcca
ttccatattaaattattgaataacgatatatttagaagcggtaaatttaatacaaacttt
ttagagcaaaatagcattatgaatgatgaaggttaa

DBGET integrated database retrieval system