KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02363Help
Entry
SAOUHSC_02363     CDS       T00324                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00010  Glycolysis / Gluconeogenesis
sao00053  Ascorbate and aldarate metabolism
sao00071  Fatty acid degradation
sao00280  Valine, leucine and isoleucine degradation
sao00310  Lysine degradation
sao00330  Arginine and proline metabolism
sao00340  Histidine metabolism
sao00380  Tryptophan metabolism
sao00410  beta-Alanine metabolism
sao00561  Glycerolipid metabolism
sao00620  Pyruvate metabolism
sao00625  Chloroalkane and chloroalkene degradation
sao01100  Metabolic pathways
sao01110  Biosynthesis of secondary metabolites
sao01120  Microbial metabolism in diverse environments
sao01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAOUHSC_02363
   00053 Ascorbate and aldarate metabolism
    SAOUHSC_02363
   00620 Pyruvate metabolism
    SAOUHSC_02363
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAOUHSC_02363
   00561 Glycerolipid metabolism
    SAOUHSC_02363
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAOUHSC_02363
   00310 Lysine degradation
    SAOUHSC_02363
   00330 Arginine and proline metabolism
    SAOUHSC_02363
   00340 Histidine metabolism
    SAOUHSC_02363
   00380 Tryptophan metabolism
    SAOUHSC_02363
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAOUHSC_02363
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAOUHSC_02363
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAOUHSC_02363
Enzymes [BR:sao01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAOUHSC_02363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 3919406
NCBI-ProteinID: YP_500839
UniProt: Q2FWD6
LinkDB All DBs
Structure
PDB: 

Position
complement(2184537..2185964)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADDVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagacgatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcgttattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgaattaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggattaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggtgttgggaatcctttatctgaacatcctaaagtacgcatgatgtca
tttacaggatcaggccctactggttctaaaattatggaaaaagccgctaaagattttaaa
aaggtatcattagagcttggtggcaaatcaccatatatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcagttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gatttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggatattttaaataa

DBGET integrated database retrieval system