KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02703Help
Entry
SAOUHSC_02703     CDS       T00324                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00010  Glycolysis / Gluconeogenesis
sao00260  Glycine, serine and threonine metabolism
sao00680  Methane metabolism
sao01100  Metabolic pathways
sao01110  Biosynthesis of secondary metabolites
sao01120  Microbial metabolism in diverse environments
sao01130  Biosynthesis of antibiotics
sao01200  Carbon metabolism
sao01230  Biosynthesis of amino acids
Module
sao_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sao_M00002  Glycolysis, core module involving three-carbon compounds
sao_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAOUHSC_02703 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    SAOUHSC_02703 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAOUHSC_02703 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sao04131]
    SAOUHSC_02703 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sao04147]
    SAOUHSC_02703 (gpmA)
Enzymes [BR:sao01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAOUHSC_02703 (gpmA)
Membrane trafficking [BR:sao04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAOUHSC_02703 (gpmA)
Exosome [BR:sao04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAOUHSC_02703 (gpmA)
  Exosomal proteins of melanoma cells
   SAOUHSC_02703 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 3919722
NCBI-ProteinID: YP_501165
UniProt: Q2FVK8
LinkDB All DBs
Position
complement(2484752..2485438)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgaacgccactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattgattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system