KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2495Help
Entry
Sulac_2495        CDS       T01746                                 

Definition
(GenBank) Alanine--glyoxylate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00250  Alanine, aspartate and glutamate metabolism
sap00410  beta-Alanine metabolism
sap00640  Propanoate metabolism
sap00650  Butanoate metabolism
sap01100  Metabolic pathways
sap01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Sulac_2495
   00650 Butanoate metabolism
    Sulac_2495
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sulac_2495
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sulac_2495
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sap01007]
    Sulac_2495
Enzymes [BR:sap01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Sulac_2495
Amino acid related enzymes [BR:sap01007]
 Aminotransferase (transaminase)
  Class III
   Sulac_2495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEW05957
UniProt: G8TW30
LinkDB All DBs
Position
complement(2471660..2472985)
Genome map
AA seq 441 aa AA seqDB search
MANIKDRQKRYLVPGVTTYYEKPLVLVKGDGRRVTDATGRTYLDFFGGILTVSVGHAHPA
IAAAVTDQVNQLVHTSTLYITEPMVDLAEKLAEITPGDLEQSFFTTSGTEANETAVAMAQ
LATGHQDVLALRHSYSGRSQAAMGLTGQSAWKLGGAGMALPIRHTQNAYCYRCPFGKTPD
RCGLECARDAEAFIRTATSGRLAALIAEPIQGVGGFITPPPAFFQELVPIVRKFGGLFID
DEVQTGFGRTGKRFGIEHYGVVPDIMTFAKGLANGLPIGATVTTAAIGARYTGPTISTFG
GNPLSMRAALATLNVIETENLTENARVTGLLLREGLEELSDRYPAIGDVRGLGLMQGLEW
VRHDKTPAPDLAAEFLEATGELGLLVGKGGLYGNVIRIAPPLTVTVSEVREALELMNQAT
ALVYAHHPELQDIPSTRIHYV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
ttggccaatatcaaagaccggcaaaaacggtatttggtgccgggtgtcaccacctactat
gaaaaacctttggtgcttgtcaaaggagacggccgtcgggtgacggatgcgacgggtcgg
acctatttagatttttttggcgggattttaacggtatccgtgggtcacgcccatcccgcg
attgctgcggcggtaacggatcaggtcaatcaattggtgcatacgtcgacgctttatatt
accgaaccgatggtggacttagccgaaaagttggccgagatcacaccgggcgacctcgaa
cagagtttctttaccaccagcggcaccgaagctaacgaaacggcggtggccatggcacag
ttggctaccggccatcaagacgtgttggctttgcggcacagctactccggtcgctcccag
gcagccatggggttaaccggccaatcggcctggaaattaggcggagccgggatggcgctt
cctattcggcatacgcagaacgcctattgctaccggtgtccctttggcaaaaccccggac
cgttgtggcttagagtgtgctcgggatgccgaagcctttatccggacggcgacctcgggc
cggttggccgcgttaattgcggaacccattcaaggggttggcggattcattaccccgccg
ccggcattttttcaagaattggttccgattgtgcgaaaatttggcggcctttttatcgac
gacgaagtacagaccggatttggtcggacgggcaaacgctttgggattgagcactacggt
gtcgtcccggatattatgacgtttgccaaggggctggctaacggcttgccgattggcgcc
acggtgacaaccgccgccattggcgcccgttataccgggccgaccatttccacctttggc
ggcaatccgctgtcgatgcgagcggcgttagcgacgttgaacgtcatcgagaccgaaaac
ttgacggaaaacgcccgggttaccggtcttttgcttcgtgaagggctcgaagagctctcc
gatcggtatccggccatcggggatgtgcgaggactggggttaatgcaagggttggaatgg
gtccgacacgataaaaccccggcgccggatctcgcggcggaatttttggaagccaccggc
gaattgggccttttagtgggtaaagggggactctacggaaacgttatccgcattgcccca
ccgctcaccgttaccgtcagtgaagtgcgggaggccctcgaactgatgaatcaagcaacg
gcattggtgtacgctcaccacccggagcttcaagatattccttcgacccgtattcattac
gtttaa

DBGET integrated database retrieval system