KEGG   Spiroplasma apis: SAPIS_v1c08380Help
Entry
SAPIS_v1c08380    CDS       T02945                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sapi  Spiroplasma apis
Brite
KEGG Orthology (KO) [BR:sapi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sapi01001]
    SAPIS_v1c08380
Enzymes [BR:sapi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SAPIS_v1c08380
Protein kinases [BR:sapi01001]
 Serine/threonine kinases: Other
  Bacterial family
   SAPIS_v1c08380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal APH Haspin_kinase ABC1
Motif
Other DBs
NCBI-ProteinID: AHB36683
UniProt: V5RJN2
LinkDB All DBs
Position
complement(998609..999619)
Genome map
AA seq 336 aa AA seqDB search
MRNYEVGQLLAERYEVVSPIGKGGMASVYKAFDIITERMVAVKVVAPEIIVKQTGQERFE
IEKEAFAKLSSNTNVVQLFDFFQSGDEWFIILECVEGGTLKDKLQRQGAMTLKEIKYYFG
NLCDALQAAHNLGIVHRDIKPDNVLLTQSGEVKLGDFGISVMEGFTSEAAKAIGTPKYMP
PEVIEAKKATPRSDIYSLGIMLYEFSTGVAPFLAKDAKKIATKHIKEKPTAPRLINPTIP
QSLENIILRMIEKDPDNRYFSMKEVQSDLMSVKITDAPKPYVYHLKNTIHTDRGSLHIKL
GTAVEKLPFILKNKFIITSLLLALLLLIALVVAMVI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaattacgaagtgggtcaattgttggcggagagatacgaagttgtttcacctatt
ggtaaaggtggaatggcatcggtctataaagctttcgatataattacagagagaatggtt
gcggtaaaagtagttgcacccgaaataatagttaagcaaactggccaagaaagattcgaa
atcgaaaaagaagcttttgctaagctaagttcaaatactaatgtagttcaactttttgat
ttttttcaatctggtgacgagtgatttattattttagagtgtgttgaaggcggaacttta
aaagacaaattacaaagacaaggtgcaatgacactaaaagaaataaaatactactttgga
aatttatgtgatgcacttcaagcagctcataatttaggaattgttcatcgtgacataaaa
ccagataatgtacttctaacacaaagtggcgaagtaaaattaggggattttggaatatct
gtaatggaaggattcactagtgaagcagccaaggccattggaacaccaaagtatatgcca
cccgaagtgattgaagcaaaaaaggcaacaccaagaagcgacatctattcattaggtatt
atgttatatgagttttcaacaggagttgccccgtttctagcaaaagatgcaaaaaaaatc
gcaactaagcacattaaagaaaaacctacggcacctaggctgattaatccgacaattcct
caaagtttagaaaatatcatactaagaatgattgaaaaagacccggataatagatatttc
tctatgaaagaagttcagtcggatttaatgagtgtcaaaattacagatgcaccaaaacct
tatgtatatcatttgaaaaatactattcatacagataggggctcactacatattaagtta
ggaacagcggttgaaaaattaccatttatattgaaaaacaagttcatcataacttcattg
cttctagcattattactattgatagcattagtggttgctatggttatttaa

DBGET integrated database retrieval system