KEGG   Salinispora arenicola: Sare_0828Help
Entry
Sare_0828         CDS       T00613                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
saq  Salinispora arenicola
Pathway
saq00620  Pyruvate metabolism
saq00680  Methane metabolism
saq01100  Metabolic pathways
saq01120  Microbial metabolism in diverse environments
saq01200  Carbon metabolism
Module
saq_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sare_0828
  09102 Energy metabolism
   00680 Methane metabolism
    Sare_0828
Enzymes [BR:saq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Sare_0828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase Phage_TAC_6
Motif
Other DBs
NCBI-ProteinID: ABV96746
UniProt: A8M2X8
LinkDB All DBs
Position
complement(925785..928571)
Genome map
AA seq 928 aa AA seqDB search
MTDQHDHDGPDAALRADIRRLGTLLGQTLARQEGRPLLDLVEDIRAQVRTDAPAAAQRLA
GLDVATGTRLARAFSTYFHLANITEQVHRARDLRRRRAIQGGWLDQAAKMIAERGVPAEE
IAAAARRLAIRPVFTAHPTEAARRSILSKLRAIADELDTETTNAVLYGASDEGPANRRLA
ELLDLMWQTDELRLDRPDPTDEARNAIYYLRDLYAEAAPQVLDDLADTLRTLGVETSPTA
RPLTFGTWIGGDRDGNPFVTPTVTREVLAIQHEHGLAATERAMDQLINEVSVSRRLRGVS
LDLSASLATDLDALPEVAPRFRRVNAEEPYRLKARCVKAKLANTRQRLRQGTAHVPGRDY
RGSGELIADLELLRASLARNSGQLTAVGRLASTIRTVSAFGLHLATMDVREHAEKHHEVL
TQLFGAVGEVSDYPALSRLERTKLLADELTGRRPLSTVDTPLTESARRTFDVFGTIREAQ
DRFGTEVIESYIISMTLGVDDVLAAVVLAREAGLVDVHSSRARIGFVPLLETPAELNAGG
DLLDELLSLPAYRALVAARGDVQEVMLGYSDSNKEAGITTSQWSIHRAQRALRDVAARHG
VHLRLFHGRGGTVGRGGGPTHDAILAQPYGTLDGEIKVTEQGEVISDKYTLPALARENLE
LTVAAVLQSTLLHTAPRQPAEMLERWDATMDVVSAAAYRSYRDLVEDPDLPAYFWASTPT
ELLGALNIGSRPAKRPNTGAGLAGLRAIPWVFGWTQTRQIVPGWFGVGSGLAAARAAGHA
DVLAEMHRSWHFFRTFLSNVEMMLTKTDLAIARRYVETLVPKKLHPIFHKIEQEYELTRR
EVLAVTVTPDLLENAPVLQRTLAVRDTYLEPLHHLQVALLRQYRESGAPGRAVATAPGGR
RAPSDGTALERALLTTVNGIAAGMRNTG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaccagcacgaccacgacggcccggacgccgcgctgcgcgcggacatccgccgc
ctcggcaccctgctcggccagactctcgcccgccaggagggtcggcccctgctcgacctc
gtcgaggacatccgcgcccaggtccgcaccgacgccccggcggccgcgcagcggctcgcc
gggttggacgtcgccaccggtacccggctcgcccgcgccttctccacgtacttccacctg
gccaacatcaccgaacaggtccatcgcgcccgggatctgcgccgccgccgggccattcag
ggtggctggctggaccaggccgccaagatgatcgccgagcgcggtgtccccgccgaggag
atcgcggcggcggcgcggcggctggccatccgtcccgtcttcaccgcccaccccaccgag
gccgcccgccgctcgatcctgagcaagctgcgcgcgatcgccgacgagttggacaccgag
accaccaacgcggtcctctacggcgccagcgacgagggcccggccaaccgccgcctcgcc
gagctgctcgacctgatgtggcagaccgacgagctccggctcgaccgcccggacccgacc
gacgaggcacgaaacgccatctactacctgcgcgacctgtacgccgaggccgctccgcag
gtgctcgacgacctcgccgacacgctgcgtacgctcggggtggagacctcgcccaccgcc
cgtccgctcaccttcggcacctggatcggtggcgaccgggacggcaacccgttcgtgacg
cccacggtgacccgggaagtcctggccatccaacacgagcacggcctcgccgccaccgag
cgggccatggaccagctgatcaacgaagtgtccgtctcccggcggctgcgcggcgtctcg
ctggacctctccgcaagcctcgccaccgacctggacgcgctgcccgaggtggcgccccgg
ttccggcgcgtcaatgctgaggagccgtaccggctcaaggcccggtgcgtgaaggcgaag
ctggccaacacccggcagcggctgcggcagggcacggcgcacgtgccgggacgggactac
cgtgggtcgggcgagctgatcgccgacctggagctgctacgcgcctcgctggcccgcaac
tccggtcagctcaccgcggtgggccggctcgcctcgaccatccgcacggtctccgccttc
ggcctgcacctggccaccatggacgtacgcgaacatgccgagaagcaccacgaggtgctg
acgcagctgttcggtgcggtgggcgaggtgtcggactacccggcactgagccggctggag
cgcaccaagttgctcgccgacgaactgaccggacgtcgacccctgtccaccgtcgacacc
ccactcaccgagtcggcccgacggacgttcgacgtcttcggcaccatccgggaggcgcag
gaccggttcgggaccgaggtgatcgagtcctacatcatctcgatgaccctcggcgtggac
gacgtcctggccgccgtcgtgttggcccgggaggccgggctggtggacgtgcacagcagc
cgggcccggatcggcttcgtgccgctgctggagaccccggccgagttgaacgccggcggt
gacctgctggacgagctgctgtcgctgcccgcctaccgggccctggtcgcggcccgcggc
gacgtccaggaggtgatgctcggctactccgactccaacaaggaggccggcatcaccacc
agccagtggtccatccaccgggcccagcgcgcgctgcgcgacgtggccgcccggcacggc
gtgcacctgcggctcttccacggccggggcggcaccgtcggccggggcggtgggccgacg
cacgacgcgatcctggcccagccgtacggcaccctcgacggcgagatcaaggtgaccgag
cagggtgaggtgatctccgacaagtacaccctgccggcgctggcccgggagaacctggag
ctgaccgttgccgcggtgctccagtcgacactgctgcacaccgcgccccggcagccggcc
gagatgctggaacgctgggacgcgacaatggacgtggtgagcgcggcggcctaccgctcg
taccgggacctggtcgaggatccggacctgccggcgtacttctgggcgtccacaccgacc
gaactgctgggcgcgttgaacatcggttcccggccggcgaagcggccgaacacgggcgcc
gggctcgccggcctgcgggccatcccgtgggtgttcggctggacccagacccgacagatc
gtccccggctggttcggtgtcggctccggcctggcggcggcccgtgccgccggccacgcg
gacgtgctcgctgagatgcaccgcagttggcacttcttccggacgttcctgtcgaacgtg
gagatgatgctgaccaagaccgacctggcgatcgctcgccggtatgtggagacgctggtg
ccgaagaagctgcacccgatcttccacaagatcgagcaggagtacgagttgacccggcgg
gaggtgctcgccgtgaccgtgaccccggacctgctggagaacgcgccggtgctgcagcgc
acgctggccgtacgggacacctacctggagccgctgcaccacctccaggtggcgttgctg
cggcagtaccgtgagtccggtgcgccgggccgggcggtggcgacggcgccgggtggccga
cgggcgccgagcgacggcaccgctctggaacgcgccctgctcaccacggtcaacggcatc
gccgccggcatgcgcaataccggctga

DBGET integrated database retrieval system