KEGG   Salinispora arenicola: Sare_1489Help
Entry
Sare_1489         CDS       T00613                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase LZ_Tnp_IS481
Motif
Other DBs
NCBI-ProteinID: ABV97387
UniProt: A8LUN4
LinkDB All DBs
Position
complement(1715823..1716932)
Genome map
AA seq 369 aa AA seqDB search
MKLPISPPVEPMLAKSVARIPTAPGMTYEPKWDGFRCIVFRDGDEVELASRGGKLMTRYF
PEVVEQARRQLPERCAVDGELIVIRRDGPGGQPRLDFELLAQRIHPAASRVRLLAETTPA
DFVAFDLLALADESFLDRPYPDRRSRLEAALGGVAPPMHVTQVTTDPATAHRWFDRFEGA
GLDGLIAKPADLPYEPGKRLMFKVKHTRTADVVVAGFRWHKSGPVVGSLLLGLYDDAGVL
HHVGVSASFPMARRKELLDELEPYRGAGADHPWAHGDHQRGQRIPGGVSRWTGTKNLEWE
PLRPELVVEVSYDAMEGDRFRHTAQFVRWRPDRKPRSCRYDQLDRPVRFDVDQVLRGDPA
SVGPASGPE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctgccgatcagtccgccggtcgagccaatgctcgccaagagcgtggcacggatt
cccaccgcgcccgggatgacatacgagccaaagtgggacggctttcggtgcatcgtgttc
cgcgacggtgacgaggtcgagttggccagccggggcggcaagttgatgacgcgctacttc
cccgaggtggtcgagcaggcccgccgacagttgccggagcgctgcgcggtcgacggggag
ctgatcgtgatccggcgcgacgggcccggcgggcagccccggctggacttcgagctgctg
gcccagcgcatccacccggccgcctcccgggtacgcctgctggccgagaccacacccgcg
gatttcgtggcgttcgatctactcgccctcgccgacgagtccttcctcgaccggccgtac
ccggaccgacggtcccggctggaggcggcgttgggcggcgtcgcgccaccgatgcacgtc
acgcaggtcaccaccgacccggccaccgcgcaccgctggttcgaccggttcgagggtgcg
gggctggacggcctgatcgccaagccggccgacctgccgtacgagccgggcaaacggctg
atgttcaaggtcaagcacacgcggacagccgatgtcgtggtggcgggtttccgctggcac
aaatccggcccggtggtcgggtcactcctgctcggcctctacgacgatgccggagtcctg
catcatgtaggggtgagcgcgtcgttcccgatggcacgccgcaaggagctgttggacgag
ttggagccataccggggtgccggtgccgaccatccctgggcgcacggcgaccaccaacgc
ggccagcgcattccgggtggggtcagccggtggaccggcacgaaaaacctggagtgggaa
ccgctgcggccggagttggtggtcgaggtgagctacgacgcgatggagggtgaccggttc
cggcacaccgcccaattcgtccgttggcgcccggaccgcaagccccgatcctgccgctac
gaccagctcgaccgcccggtccggtttgatgtggatcaggtgctccggggcgatccggca
agcgtcggccccgcgtccgggccggagtag

DBGET integrated database retrieval system