KEGG   Salinispora arenicola: Sare_2034
Entry
Sare_2034         CDS       T00613                                 

Definition
(GenBank) DegT/DnrJ/EryC1/StrS aminotransferase
  KO
K21328  dTDP-4-amino-4,6-dideoxy-D-glucose/dTDP-4-amino-2,4-dideoxy-beta-L-xylose transaminase [EC:2.6.1.33 2.6.1.-]
Organism
saq  Salinispora arenicola
Pathway
saq00523  Polyketide sugar unit biosynthesis
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Sare_2034
Enzymes [BR:saq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     Sare_2034
    2.6.1.-  
     Sare_2034
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Beta_elim_lyase
Other DBs
NCBI-ProteinID: ABV97904
UniProt: A8LZP1
LinkDB
Position
complement(2328286..2329416)
AA seq 376 aa
MIPLSKIAMSPDVDRRISAVLHSGRLEHGPTVAEYEATVGERVGNPRVVSVNCGTAGLHL
ALSLAARPGPGQADRAEPGEVLSTPLTFEGTNWPALANGLRVRWVDVDPATLNVDLDDLA
AKISPATRAIVVVHWLGYPVDLNRLCAVVDQAAARYGHRPLIIEDCAQAWGATYRGTPLG
THGNVCVFSTGAIKTLTTGSGGLVVLPDDDLHERLRLRRWLGIERASARITGDYDVAEWG
YRFVLNEIGGAIGLSNLEHVDELLRRHRENAAYYDKELTGLDGVEHTERADDREPSFWVY
PLKVRDRSAFMCRLRDAGIASSVISRRNDAHSCMASSRAHLPGLDSVADRVVYIPVGWWL
TAEDRSHVVETIRSGW
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgatcccgttgtccaagatcgccatgtcgccggacgtcgaccgccgcatctccgccgtg
ttgcacagcggacgcctggagcacgggccgaccgtggccgagtacgaggcgacggtcggc
gaacgcgtcggcaatccccgcgtcgtgtcggtcaactgcggcaccgccggactgcacctg
gccctcagcctcgccgcccgccccggccccgggcaagccgatcgggccgaaccgggtgag
gtgctgagtaccccgctgaccttcgagggcaccaactggccagccctcgccaatgggctg
cgggtgcgctgggtcgatgtcgacccggcgacgctcaacgtcgacctcgacgatctggcg
gccaagatctcaccggccacccgggccatcgtggtcgtgcactggctcggataccccgtg
gacctcaaccggctctgcgccgtggtggaccaggccgcagccaggtacggacaccggcct
ttgatcatcgaggactgcgctcaggcgtggggcgccacctaccggggcaccccgctcggc
acgcacggcaacgtctgcgtgttcagcaccggcgcgatcaagacgctcaccaccggcagt
ggcggactggtcgtgctgcccgacgacgacctgcacgagcggctgcggctccgccggtgg
ctgggcatcgagcgagcctcggcccggatcaccggcgactacgacgtggccgaatgggga
taccggttcgtcctcaacgagatcggtggcgcgatcgggctgtccaacctggaacacgtc
gacgaactactgcgccggcaccgggagaacgccgcctactacgacaaggagttgaccggt
ctcgacggcgtcgaacacaccgaacgcgccgacgaccgggaaccctcgttctgggtgtac
cccctgaaggtacgcgaccgttccgccttcatgtgccgactgcgcgacgccggcatcgcc
agcagtgtcatctcccgccgcaacgacgcgcacagctgcatggcgtcatcacgagcccac
ctacccggcctggactcggtggccgaccgggtggtctacatcccggtgggctggtggctc
accgcggaggaccgttcccacgtcgtcgaaacgatcagatccggctggtga

DBGET integrated database retrieval system