KEGG   Salinispora arenicola: Sare_2341Help
Entry
Sare_2341         CDS       T00613                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
saq  Salinispora arenicola
Pathway
saq00250  Alanine, aspartate and glutamate metabolism
saq00410  beta-Alanine metabolism
saq00430  Taurine and hypotaurine metabolism
saq00650  Butanoate metabolism
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
saq01120  Microbial metabolism in diverse environments
saq02024  Quorum sensing
Module
saq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Sare_2341
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sare_2341
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sare_2341
   00430 Taurine and hypotaurine metabolism
    Sare_2341
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Sare_2341
Enzymes [BR:saq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Sare_2341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Varsurf_PPLC
Motif
Other DBs
NCBI-ProteinID: ABV98199
UniProt: A8M283
LinkDB All DBs
Position
2693827..2695227
Genome map
AA seq 466 aa AA seqDB search
MPNTRRSIDSFGPGVVGLNPMFARPGEATELARFSIPDDESLPETAYQIVHDEVALDGNA
RLNLATFVGTWMDSHAEKLFAETFDKNLIDKDEYQATDVIETRCRTILADLWHAPEPRNA
VGTSTIGSSEACMLGGLALKRRWQHARRSAGQSTDRPNLVMSSAVQVCWKKFCNYWDVEA
RTVPISEERRVLDGHDLRSYVDENTIGVVALLGVTYTGMYEPVERIAAALDDIQAATGWD
IPIHVDGATGAFIAPFIQPDLVWDFRIGRVASINASGHKYGLVYPGLGWIVWRDQVALPD
DLRFRVAYLGGDTPTVGLSFTRPGSHVLLQYYLFLRLGRDGFRRVQQATHDVAQYLSREI
AAMPQFELWSDGSDIPVLTWHLRKGPSWNWNLYHLSDRLRMKGWKVPTYPMPEDLTDLTV
QRIVVRNGLSRDLAGVFIADLHAEVAFLESLTVPITTLGQRPGFHH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacacccggcgaagtatcgactccttcggtcctggcgtggtcggactgaacccg
atgttcgcgcgtccgggtgaggcgactgagcttgcccgattctcgattccggacgacgag
tcgctaccggaaaccgcataccagatcgtgcacgacgaggtggccctcgacgggaacgca
cggctcaacctcgccacgttcgtcggcacctggatggacagccatgccgagaagttgttc
gccgagacgttcgacaagaatctgatcgacaaggacgagtatcaggctaccgacgtcatt
gagacccggtgccggaccatcctggcggatctctggcacgcgcccgagccccggaacgcc
gtcggcacgtccacgatcggttcgtccgaggcgtgcatgctgggtggtctggcgctcaag
cgacgctggcagcacgcgcgtcgcagcgccggccagtccacggatcgccccaatctggtg
atgtcgagcgcggtgcaggtgtgttggaagaagttctgcaactactgggacgtcgaggcc
cgaaccgtgccgatctccgaggagcgcagggtgctcgacggccacgaccttcggtcgtat
gtggacgagaacaccatcggtgtcgtggcgctcctgggtgtgacgtacaccgggatgtac
gagccggtcgaacggatcgcggcggcactggacgatatccaggcggcgaccggatgggac
atccccattcacgtcgacggagctacgggtgcattcatagcgccgtttatccaacctgac
ctggtctgggacttccgtatcgggagggtggcttcgatcaatgcatcgggacacaagtac
ggcctggtctacccgggcctggggtggattgtctggcgagatcaggtggcactgcccgat
gacctgagattccgggtagcctacctggggggcgatacaccaacggtcgggttgagtttc
acccggccgggatcccatgtgctactgcagtactacctcttcctgcgcctcggccgggac
ggttttcggcgagtgcagcaggccacgcacgacgtcgcacagtacctgtcccgggagatc
gcagcaatgccgcagttcgagttgtggagtgatggcagcgacattccggtgctgacgtgg
catctccggaaggggccttcctggaactggaacctgtaccacctgtccgatcgactgcgc
atgaaggggtggaaggttcccacgtacccgatgcccgaggacctgacggacctcaccgta
caacggatcgtggtccgtaacgggctcagtcgcgatctcgccggggtcttcatcgccgac
ctccacgcggaggtagcgtttctcgaatcccttaccgttcctatcacgactttgggtcag
cgacccgggttccatcattga

DBGET integrated database retrieval system