KEGG   Salinispora arenicola: Sare_2945
Entry
Sare_2945         CDS       T00613                                 

Definition
(GenBank) DegT/DnrJ/EryC1/StrS aminotransferase
  KO
K21328  dTDP-4-amino-4,6-dideoxy-D-glucose/dTDP-4-amino-2,4-dideoxy-beta-L-xylose transaminase [EC:2.6.1.33 2.6.1.-]
Organism
saq  Salinispora arenicola
Pathway
saq00523  Polyketide sugar unit biosynthesis
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Sare_2945
Enzymes [BR:saq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     Sare_2945
    2.6.1.-  
     Sare_2945
SSDB
Motif
Pfam: DegT_DnrJ_EryC1
Other DBs
NCBI-ProteinID: ABV98771
UniProt: A8M798
LinkDB
Position
3336882..3338018
AA seq 378 aa
MIPLFKVAMTPGAADAVTEVLRSGRLEHGPVAANFETALAERIGNPRVLTLNSGTSGLHL
AIDLATRPARGAGVPADDVPGEILSTPLTFEGTNWPILASGRRIRWIDVDPRTLNVDLDD
LESKISPACRAIMVVHWAGYPVDLNRLRAIVDRAEVRHGIRPVVIEDCAQAWAATYDGLP
LGRHGNVSVFSFGALKPLTCGSGGLIVVPDDEMYDRARLRRWFGIDRQADRTTGDYDVAD
WGFRFYMNDVAAAIGLANLVAADGLIERSRANAAFFDRELAGVPGLRQTERSPDREPSHW
IYPVLIDDRSSFVRKLTDSAIATGIVSRRNDAHSCVASVREHLPGLDWVADRLAYLPVGW
WLSEADRDHVVSTIRAGW
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgatccctctcttcaaggtcgcgatgacgcccggcgccgccgacgcggtcaccgaggtc
ctccggagcggccgtctggagcacggtcccgtggccgcgaacttcgaaacggccctcgcc
gaacgaatcggcaacccccgagtactcactctcaattcgggcacctccggcctgcatctg
gcgatcgacctggctaccagacccgcccgtggcgcaggggtgccagccgacgacgtaccc
ggtgagattctcagcacgcccctcacgttcgaagggacgaactggccgatccttgcgagt
ggtcggcgcattcgctggatcgacgtcgatccgcggaccctgaacgtggacctcgacgac
ctggagagcaagatttcgcccgcctgccgcgcgatcatggtcgtccattgggcgggctat
ccggtggacctcaaccgactgcgggccatcgtggatcgagctgaggtgcgacacgggata
cggcccgtggtgatcgaggactgcgcccaggcatgggcggcgacgtacgacgggctgccc
ctgggcaggcacggcaatgtctcggtattcagcttcggggcactgaagccgctcacgtgc
ggtagcggcggccttatcgtggttcccgacgacgagatgtacgaccgtgcccggctgcgg
cggtggttcggcatcgaccgtcaggctgatcgcaccacgggtgactacgacgtggcggac
tggggctttcgcttctacatgaacgacgtcgccgcggcgataggactggcgaatctggtg
gcggccgacggcctgatagagcggtctcgggccaacgccgccttcttcgatcgcgagttg
gcgggtgtgccggggctgcggcagaccgaacgctcccccgaccgcgaaccgtcacactgg
atctatcccgtcctgatcgacgaccggtcgtcgttcgtacgaaagctcaccgactccgcc
atcgccaccggcatcgtgtctcgccgcaacgatgcgcacagctgtgtcgcctcggtgcgc
gaacaccttcccggattggactgggtcgccgaccggctcgcctacctgcctgtgggatgg
tggctcagcgaggccgaccgtgaccacgtcgtgagcacgattcgggccggatggtag

DBGET integrated database retrieval system