KEGG   Salinispora arenicola: Sare_3215Help
Entry
Sare_3215         CDS       T00613                                 

Definition
(GenBank) aminotransferase class-III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
saq  Salinispora arenicola
Pathway
saq00250  Alanine, aspartate and glutamate metabolism
saq00410  beta-Alanine metabolism
saq00640  Propanoate metabolism
saq00650  Butanoate metabolism
saq01100  Metabolic pathways
saq01120  Microbial metabolism in diverse environments
Module
saq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Sare_3215
   00650 Butanoate metabolism
    Sare_3215
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sare_3215
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sare_3215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:saq01007]
    Sare_3215
Enzymes [BR:saq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Sare_3215
Amino acid related enzymes [BR:saq01007]
 Aminotransferase (transaminase)
  Class III
   Sare_3215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABV99022
UniProt: A8LV30
LinkDB All DBs
Position
complement(3706499..3707809)
Genome map
AA seq 436 aa AA seqDB search
MTADDLLARHRNVLPSWMPLYYDEPIELVAGQGRRVTDAQGRTYLDFFGGVLTNSIGYDI
PEIRAAVERQLRTGLVHTSTLYLIRQQVELAEKVARLSGISDARVFFTNSGTEANEAALL
MATNYRRSHQILAVRNSYHGRSYATIGVTGNRGWSASPLNPLQVAWLHSGERLRGLLARL
PEADRIDAAVEDLREVLATQTSGDVACLIAEPIQGVGGFVHGPDGLLAGWRKVLDEHGIL
LVSDEVQTGWGRTGTHFWGYQAHGVTPDMITFAKGIGNGFALAGVVGRAEVVESVPAISF
STFGGNPIAAAAGNAVLDYLLDNDLQANADRVGAILNDGLRAAVGGLPGVAEVRGKGLML
GVEFVHPGTADPDPGRAAQVFEACRDGGLLVGKGGLYGNVVRMGPPLTLTEQEAREGLAI
LVDAIRSGGTASEAAA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgacgacctgctggcccggcaccggaatgtgcttccgtcctggatgcccctc
tactacgacgaaccgatcgaactcgtcgctggccaggggcgccgggtcaccgatgcgcag
ggtcgcacctacctggatttcttcggcggtgtgctgaccaacagcatcggctacgacatt
ccggagatccgcgcggcggtggagcgccagttgcgcaccgggctcgtgcacacctcgacg
ctctacctgatccgacagcaggtggagctggccgagaaggtggcccggctgtccgggatc
agcgacgcgcgggtcttcttcaccaactccggcaccgaggccaacgaggccgcgttgctg
atggccaccaactaccggcgctcgcaccagatcctcgccgtgcgcaacagctatcacggc
cggtcgtacgcgaccatcggcgtcaccggcaaccgcggctggtcggcgagcccactgaac
ccgttgcaggtggcctggctgcactcgggtgagcggctgcggggtctgctcgcccggcta
cccgaggcggaccggatcgacgcggcggtggaggacctgcgtgaggttctggccacccag
acctcgggcgatgtcgcctgtctgatcgccgaaccgatccagggcgtcggcgggttcgtc
cacggcccggacgggcttctcgccggctggcgtaaggtgctcgacgaacacggcatcctg
cttgtctcggacgaggtgcagaccggctgggggcgtaccggcacgcacttctggggctac
caggcgcatggggtcaccccagacatgatcactttcgccaagggcatcggcaacgggttc
gctctcgccggcgtggtcgggcgggctgaggtggtcgagtcggtgccggcgatcagcttc
tccaccttcggtggtaaccccattgccgccgccgccggcaacgccgtgctcgactatctg
ctcgacaacgatctgcaggccaacgcggaccgggtcggtgcgatcctcaacgacggactg
cgcgccgcggtcggcgggctgcccggggtcgccgaggtacgcggcaaggggctgatgctc
ggcgtcgagttcgtccacccgggcaccgccgacccggatcctggtcgagccgcccaggtg
ttcgaggcgtgtcgggacggcggcctgctcgtcggcaagggcggcctctacgggaacgtg
gtgcggatgggaccaccgttgacgctgaccgaacaggaggcccgggagggcctggccatt
ctggtggacgcgatccgctccggcgggacagcgtcggaggcggcggcatga

DBGET integrated database retrieval system