KEGG   Salinispora arenicola: Sare_3825
Entry
Sare_3825         CDS       T00613                                 

Definition
(GenBank) undecaprenyl diphosphate synthase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
saq  Salinispora arenicola
Pathway
saq00900  Terpenoid backbone biosynthesis
saq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sare_3825
Enzymes [BR:saq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     Sare_3825
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: ABV99618
UniProt: A8M0V7
LinkDB
Position
complement(4357633..4358415)
AA seq 260 aa
MPVPPTPHPSGARPPVLPAEALPRHVAVVMDGNGRWAKERGLPRTKGHEAGEFSLFDAVE
GAIELGIPYLSAYAFSTENWRRSPDEVRFLMGFNRDVIRRRRDQLVDLGVRVVWSGRAGR
LWKSVITELQTAEEMSRGNSTLTLQFCVNYGGQAEIADAAAAIARDVAAGRLDPAKVTEK
MVARYLYHPEIPEVDLFLRPSGEQRTSNFLLWQSAYAELVFLDTLWPDFDRRHLWYACEL
YAQRDRRFGGALPNPVAPTT
NT seq 783 nt   +upstreamnt  +downstreamnt
gtgccggtgccgcccaccccccacccgtccggtgcccggccaccggtgttgcccgccgag
gcgctgccgcggcacgtcgcggtggtgatggacggtaacggccggtgggccaaagaacgc
gggctccctcgcaccaaaggacacgaggcgggagagttctccctctttgacgccgtcgag
ggcgcaatcgaactgggcatcccgtacctgtcggcctacgcgttctcgaccgagaactgg
cggcgctcgccggacgaggtgcgcttcctgatgggcttcaaccgggatgtgatccgtcgc
cgtcgggaccagctcgtcgacctgggcgtacgagtcgtctggtcgggtcgggccgggcgg
ttgtggaagagcgtcatcacggagctgcagaccgccgaggagatgtcccgcgggaactcg
acgctcaccctgcagttctgcgtcaactacggtggtcaggccgagatcgccgatgccgcc
gccgcgatcgcccgggacgtcgctgccggccgtctcgacccggccaaggtcaccgagaag
atggtggcccggtacctctaccacccggagatccccgaagtggatctcttcctgcggccc
tccggcgagcagcgcacctcgaacttcctgctctggcagagcgcatacgccgaactggtc
ttcctggacacgctctggccggacttcgaccgccgccacctctggtacgcctgtgaactg
tacgcccaacgggaccgtcgattcggcggggcgttgccgaacccggtggcccccaccacc
tga

DBGET integrated database retrieval system