KEGG   Salinispora arenicola: Sare_4077Help
Entry
Sare_4077         CDS       T00613                                 

Definition
(GenBank) Superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
saq  Salinispora arenicola
Brite
KEGG Orthology (KO) [BR:saq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sare_4077
Enzymes [BR:saq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sare_4077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: ABV99867
UniProt: A8M3A4
LinkDB All DBs
Position
4637960..4638364
Genome map
AA seq 134 aa AA seqDB search
MRLPRILTPRVTASAHCDLPCGVYDPAQARIEAESVKMICEKYQANTDPEFRTRAILIKE
QRAELVKHHLWVLWTDYFKPAHFEKYPQLHQLFNEATKLAGAAGAKGATDPAKADELLQK
IDEISKIFWETKKA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttccacgcatccttaccccccgagtgaccgccagcgcccactgcgatctgccg
tgcggtgtctacgacccggcgcaggcccggatcgaggccgagtcggtaaaaatgatctgc
gagaagtaccaggccaacaccgacccggagttccgcacccgggccatcctgatcaaggag
cagcgggccgagctggtgaagcaccacctgtgggtgctgtggaccgactacttcaagccg
gcccacttcgagaagtacccgcagctgcaccagctcttcaacgaggccaccaagctggcc
ggcgcggccggcgccaagggtgcgaccgacccggcgaaggccgacgagctgctgcagaag
atcgacgagatctcaaagatcttctgggagaccaagaaggcgtga

DBGET integrated database retrieval system