KEGG   Salinispora arenicola: Sare_4173Help
Entry
Sare_4173         CDS       T00613                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
saq  Salinispora arenicola
Pathway
saq00020  Citrate cycle (TCA cycle)
saq00480  Glutathione metabolism
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
saq01120  Microbial metabolism in diverse environments
saq01130  Biosynthesis of antibiotics
saq01200  Carbon metabolism
saq01210  2-Oxocarboxylic acid metabolism
saq01230  Biosynthesis of amino acids
Module
saq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
saq_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sare_4173
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Sare_4173
Enzymes [BR:saq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Sare_4173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ABV99962
UniProt: A8M3J9
LinkDB All DBs
Position
complement(4739739..4740953)
Genome map
AA seq 404 aa AA seqDB search
MAKIKVSNPVVELDGDEMTRIIWKQIREQLILPYLDVDLRYYDLSIQHRDETDDQATVDA
ANAIKEHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIIMSNVPRL
VPGWTKPIIIGRHAHGDQYKASDFVVPGPGKVTITYTPADGAQPIEMEIADFPGGGVAMG
MYNFDESIRDFARASMRYGLDRGYPVYLSTKNTILKAYDGRFKDIFAEVYENEFKADFEA
AGISYEHRLIDDMVAAALKWEGGFVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDGR
TVEAEAAHGTVTRHYRQYQKGEKTSTNPIASIYAWTRGLAHRGKLDGTPAVSEFANTLEK
VIVETVEGGQMTKDLALLISRDAPWLTTDEFMNALDENLARKLA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtaagtaacccggtcgtggagctcgacggcgacgagatgacccgg
atcatctggaagcagatccgggagcagctgatcctgccctacctcgacgtcgacctgcgg
tactacgacctctcgatccagcaccgtgacgagaccgacgaccaggccaccgtcgacgcc
gccaacgcgatcaaggagcacggtgtcggcgtcaagtgcgccacgatcaccccggacgag
gcacgggtcgaggagttcggcctgaagaagatgtggcggtcgccgaacggcaccatccgt
aacatcctcggtggcgtcgtcttccgcgagcccatcatcatgtccaacgtcccgcggctg
gtgccgggctggacgaagccgatcatcatcggccggcacgcccacggcgaccagtacaag
gccagcgacttcgtcgtccccgggccgggcaaggtcaccatcacctacaccccggccgac
ggggcgcagccgatcgagatggagatcgccgacttccccggcggcggagtcgccatgggc
atgtacaactttgacgagtcgatccgggacttcgcccgtgcctccatgcggtacggcctc
gaccgcggctacccggtctacctgtcgaccaagaacaccatcctcaaggcgtacgacggt
cggttcaaggacatcttcgccgaggtctacgagaacgagttcaaggccgacttcgaggct
gccggcatcagctacgagcaccgactgatcgacgacatggtcgctgcggcgctcaagtgg
gagggcggcttcgtctgggcctgcaagaactacgacggtgacgtgcagtccgacaccgtc
gcgcagggcttcggctcgctcggtctgatgacgtccgtgctgatgacccccgacggccgc
accgtcgaggccgaggccgcgcacggcaccgtcacccggcactaccggcagtaccagaag
ggcgagaagacctcgaccaacccgatcgcctcgatctacgcctggacccggggcctggcc
caccgaggcaagctggacggcaccccggcggtttccgagttcgccaacaccctggagaag
gtcatcgtcgagaccgtcgagggtggccagatgaccaaggacctcgcgctgctcatctcg
cgggatgccccgtggctgaccaccgacgagttcatgaacgcgctggacgagaacctggcc
cgcaagctcgcctga

DBGET integrated database retrieval system