KEGG   Salinispora arenicola: Sare_4352Help
Entry
Sare_4352         CDS       T00613                                 

Definition
(GenBank) DNA polymerase LigD ligase region
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
saq  Salinispora arenicola
Pathway
saq03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:saq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Sare_4352
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:saq03400]
    Sare_4352
Enzymes [BR:saq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Sare_4352
DNA repair and recombination proteins [BR:saq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Sare_4352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ABW00134
UniProt: A8M566
LinkDB All DBs
Position
complement(4918239..4919180)
Genome map
AA seq 313 aa AA seqDB search
MPGVPPKPMLAMTGELPAGAGWAYEFKWDGIRALADLSGGRRHVYARSGVEVTVAYPELA
GLPAQVDNALLDGEVVLFGAAGQPSFTALAERMHVRESGRAARLAATLPVTYLIFDLLRL
DGVDLTGHSWQQRRAALDGLGLAGPRWAVPPVFWDGPATYQAAGEHGLEGVMAKRVGSIY
RPGTRSPDWVKVKLEVTGDFVVGGWRPGARRLGGLLVGVPRPDGRLTFRGRVGGGIGAAL
ERELLRELEPLRAAGSPFAGDLPREDARTAVWVSPRVVVEVKYGQLTPDGRLRFPRVLRL
RPDKPAEEVDDAG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggcgtgccgcccaagccgatgctcgcgatgaccggggagttgccggcgggtgcc
ggctgggcgtacgagttcaagtgggacgggatacgcgccctggctgacctctccggcggc
cgacgacacgtgtacgcccgttccggcgtcgaggtcaccgtcgcctacccggaactggcg
ggcctgcccgcgcaggtggacaacgcactccttgatggcgaggtggtgctttttggtgcc
gctggacagccgtcgttcacggcgctcgccgagcggatgcacgtccgggagtcgggtcgg
gccgcgaggctggcggcgacgctgcccgtcacgtacctgatcttcgacctgctacgcctc
gatggcgtcgacctgaccggccactcgtggcaacaacggcgggccgccctggacgggttg
gggctggccggcccacgatgggcggttcccccggtcttctgggacggcccggccacctac
caggcggcgggggagcacggtctggagggggtgatggccaagcgggtcggttcgatctat
cggccgggtacccggtcgccggactgggtcaaggtcaagttggaggtgaccggcgacttc
gtcgtgggtggctggcggccgggagcgcgccggcttggcggactgttggtcggggtgccc
cggcccgacggccgactcacgttccgggggcgggtcggcggtggcatcggcgcggcgttg
gagcgggaactgctgcgcgagttggaaccgctgcgtgcggccggttcgcccttcgccggg
gacctgccccgcgaggacgcccggaccgcggtctgggtgtcaccccgggtcgtggtggag
gtcaagtacggccagctcaccccggacgggcgactgcgtttcccgcgggtgctgcggtta
cgtccggacaaacccgccgaggaggtcgacgatgccggctga

DBGET integrated database retrieval system