KEGG   Salinispora arenicola: Sare_4611Help
Entry
Sare_4611         CDS       T00613                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
saq  Salinispora arenicola
Pathway
saq00564  Glycerophospholipid metabolism
saq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sare_4611
Enzymes [BR:saq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Sare_4611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 NAD_binding_8 Pyr_redox GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABW00370
UniProt: A8M7K3
LinkDB All DBs
Position
5232535..5234259
Genome map
AA seq 574 aa AA seqDB search
MHSATLSLAARERSLAALSSGPELDVLVVGGGVTGAGCALDAVTRGLSVGLVEARDWASG
TSSRSSKLIHGGLRYLEMLDFGLVREALRERGLLLQRLAPHLVRPVPFLYPLRHRGWERL
YAGAGVLLYDTMSLSGSNSRGVPAHRHLTRRGAVRACPSLRPESLVGALQYYDAQVDDAR
LVTCLVRTAAAHGAYPVSRARVVGLLRDGHRVTGARVHDLETDQVLEVRARQVINATGVW
TDDIQSLVGERGPVQVRASKGIHLVVPRDRIRSTTGLILRTESSVLFVIPWGRHWLIGTT
DTDWDLDKAHPAATSRDIDYLLERVNEVLAIPLTRDDVEGVYAGLRPLLSGHSDATAKLS
REHTVANPAPGLVMVAGGKYTTYRVMARDAVDEAVRGLGGGVPRSCTDRVPLLGAEGYVA
RWNQRRRIARQYNLTVERVEHLLRRYGAAVDEVLDLLGEDPTLVEPLDGADDYLRVEVVH
AASAEGALHLEDVLTRRTHISIETFDRGLAAARPAAQLMASVLGWDAERVDREVAHYVAQ
VDAERMAHDQIDDQAADAARLVAPDVVPQVALAA
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcactccgcgacactgtcactggccgcccgcgagcggtcgctggccgcgctgagcagc
ggcccggaactggacgtcctggtggtcggtggcggcgtcaccggcgccggctgcgccctg
gacgccgtcacccggggcctgtcggtcggcctcgtcgaggcccgcgactgggccagcggc
acgtcgagccgctccagtaagctcatccacggtggtctgcgctacctggagatgctcgac
ttcgggctggtccgcgaggcgctgcgcgagcggggcctactactgcagcgactcgccccg
cacctggtccggccggtgccgtttctctacccgctgcggcaccgcggctgggaacggctg
tacgcgggcgccggtgtcctgctctacgacacgatgagcctttccggcagcaactcccgc
ggggtaccggcccaccggcacctgacccgacgtggcgcggtccgcgcttgcccgtccctg
cgtccggagtcgctggtgggcgcgttgcagtactacgacgctcaggtcgatgacgcccgg
ctggtgacgtgtctcgtccgtaccgccgcagcccacggcgcgtaccccgtttcccgagcc
cgggtcgtgggcctcctgcgcgacggccaccgcgtcaccggggcgcgggtccacgacctg
gagaccgaccaggtcctcgaggtccgcgcccggcaggtcatcaacgccaccggcgtctgg
accgacgatatccagtctctcgttggggagcgtgggccggtgcaggttcgcgcgtcgaaa
ggtatccacctcgtcgtgccccgcgaccggatccgctccaccaccggcctgatcctgcga
accgaatccagcgtgctgttcgtgatcccgtggggtcggcactggctgatcggcaccacc
gacaccgactgggatctggacaaggcgcacccggcagcgaccagccgcgacatcgactac
ctgctggaacgggtcaacgaggtactggccattccgctgacccgcgacgacgtcgagggc
gtatacgcgggcctgcggccactgctgtccgggcattcggatgcgaccgccaagctgtcc
cgtgagcacaccgtggcgaacccggcgccgggtctggtgatggtcgccggcgggaagtac
acaacgtaccgggtgatggcccgcgacgctgtcgacgaggccgtgcggggactcggcggt
ggggtgccgcggtcctgcaccgaccgggttcccctgctcggcgccgagggctatgtcgcc
cgatggaaccagcgccgtcgcatcgcgcgacagtacaacctgaccgtggagcgggttgag
catctgttgcgccgctacggagccgccgtcgacgaggtgttggacctgctgggagaggat
ccgaccctcgttgagccgctcgacggcgccgacgactatctgcgtgtggaggtcgtccac
gcggcgtcagccgagggtgccctgcacctggaggacgtgcttacccggcgtacacacatc
tcgatcgagacgttcgaccggggcctggcagccgcccgaccggcggcgcagttgatggcg
tcggtgctcggctgggacgccgagcgtgtggaccgcgaggtggcgcactacgtcgcacag
gtggacgccgaacggatggcgcacgaccagatcgacgaccaggccgccgacgcggcccgg
ctggtcgcgccggatgtggtgccgcaggtagcactcgcggcctga

DBGET integrated database retrieval system