KEGG   Salinispora arenicola: Sare_5102Help
Entry
Sare_5102         CDS       T00613                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
saq  Salinispora arenicola
Pathway
saq00473  D-Alanine metabolism
saq00550  Peptidoglycan biosynthesis
saq01100  Metabolic pathways
saq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sare_5102
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sare_5102
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Sare_5102
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:saq01011]
    Sare_5102
Enzymes [BR:saq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sare_5102
Peptidoglycan biosynthesis and degradation proteins [BR:saq01011]
 Precursor biosynthesis
  Amino acid ligase
   Sare_5102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp CPSase_L_D2 RimK TTL
Motif
Other DBs
NCBI-ProteinID: ABW00845
UniProt: A8LXJ6
LinkDB All DBs
Position
5776775..5777758
Genome map
AA seq 327 aa AA seqDB search
MGTTAADPAVLLTDLRVLVLAGGLSYERDVSLRSGRRVLDALRAVGVEAELRDADVALLP
SLVADPPDAVVIALHGATGEDGSLRGVLDLCNVPYVGCDARSSRLAWDKPSAKAVLREAG
IPTPDWVALPHDRFSELGAVAVLDRIVDRLGLPLMVKPAQGGSGLGAAVVRDGPALPAAM
VGCFAYDSTALVERYLPGTDVAVSVIDLGEGPQALPAVEIVPRNGVYDYAARYTAGRTTW
HTPARLDTEVAEAVATVAVAAHTALGLRDLSRVDLIVDADHQPHVLGVNVAPGMTETSLL
PLAAQAASLDFGRMIGTLVSRAVARAT
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggtacgaccgctgccgatccggctgtcctcttgaccgacctgcgcgtgctggtactc
gccggcggcctttcctatgaacgggacgtctcgctgcgatccggccggcgggtgctggac
gcgctgcgtgcggtgggcgtggaggcggagctacgcgacgcggacgtcgccctgctgccg
tcactcgtcgccgatccaccggacgcggtggtcatcgccctgcacggtgccactggtgag
gacggttcacttcgcggtgtgctggacctctgcaacgtcccgtacgtcggctgcgacgcc
cgctcgtcacgcctcgcgtgggacaaaccctcggccaaggccgtgttgcgggaagcgggc
atccccaccccggactgggtggcactacctcatgatcgcttctccgagctcggtgcggtg
gcggtactggaccgcatcgtcgaccgcttggggctcccgctgatggtgaagcccgcgcag
ggcggctcgggtctgggcgccgccgtggtccgggatggtccggccctaccggccgcgatg
gtcggttgtttcgcctacgactcgaccgccctcgtcgaacgctacctgcccggaacggac
gtggcggtatccgtgatcgacctcggcgaggggccgcaggccctgccggcggtggagatc
gtgccccgaaacggtgtgtacgactacgccgcccggtacacggccggccgtaccacctgg
cacacgccggcccgcctggacaccgaggtggccgaagcggtcgccacggtcgccgtcgcc
gcccacaccgcgctcgggttgcgcgacctcagccgggtcgacctgatcgtggatgccgac
caccagccgcacgtcctcggggtgaacgtcgcacccggcatgacggagacctcactgcta
ccgctcgcggcccaggccgcgagtctcgacttcggccgaatgatcggaaccttggtctct
cgggccgttgcccgggccacctga

DBGET integrated database retrieval system