KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR0245Help
Entry
SAR0245           CDS       T00182                                 

Definition
(GenBank) putative zinc-binding dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00040  Pentose and glucuronate interconversions
sar00051  Fructose and mannose metabolism
sar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAR0245
   00051 Fructose and mannose metabolism
    SAR0245
Enzymes [BR:sar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SAR0245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 PrmA Methyltransf_25 2-Hacid_dh_C Methyltransf_31 UDPG_MGDP_dh_N DUF4179
Motif
Other DBs
NCBI-ProteinID: CAG39271
GeneDB: SAR0245
LinkDB All DBs
Position
285723..286766
Genome map
AA seq 347 aa AA seqDB search
MKALKLYGVEDLRYEDNEKPVIESANDVIVKVRATGICGSDTSRYKKMGPYIQGMPFGHE
FSGVVDAIGSDVTHVNVGDKVTGCPAIPCYQCEYCLKGEYARCEKLFVIGSYEPGSFAEY
VKLPAQNVLKVPDNVDYIEAAMVEPSAVVAHGFYKSNIQPGMTVAVMGCGSIGLLAIQWA
RIFGAAHIIAIDIDAHKLDIATSLGAHQTINSKEENLEKFIENHYANQIDIAIESSGAKV
TIGQILTLPKKGGEVVLLGIPYDDIEIDRVHFEKILRNELTVCGSWNCLSSNFPGKEWTA
TLHYMKTKDINVKPIISHFLPLEKGPETFDKLVNKKERFDKVMFTIY
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctttgaaattatatggcgtggaagatttacggtatgaggataatgaaaagcca
gtcattgaaagtgcgaatgacgttattgttaaagtacgagcgactggaatatgtggttca
gacacgtcacgatacaaaaaaatggggccatacattcaaggtatgccatttggtcatgaa
ttttcaggtgttgtagatgccattggaagtgatgttacgcatgttaatgtaggcgacaaa
gtgacaggttgcccagccataccttgttatcaatgcgagtattgtttaaaaggtgaatat
gcacgatgtgaaaagttgttcgtcattggctcatatgaacctggatcgttcgcggaatat
gtcaaattgccagcgcaaaatgttttaaaggtaccagacaatgttgattacattgaagca
gcaatggttgagccatcagccgttgttgcgcatgggttttataaatcgaatatacaacct
ggtatgactgttgcagtaatggggtgtggcagtataggattgttagctattcaatgggca
cgaatatttggtgctgcgcatatcatcgctatagatatagatgcgcataaactagatatt
gctacatcattgggcgcacatcaaaccatcaattcaaaagaagaaaatcttgagaaattc
atcgaaaatcattacgccaatcaaatcgatatagctatagaatcatcaggtgctaaagtt
acgattggtcaaatattgacgctacctaaaaaaggtggcgaggtggtattactcggaata
ccatatgatgatattgagattgatcgcgttcattttgaaaaaattctgcgtaacgagttg
acagtatgtggctcttggaactgtttgtccagtaattttccggggaaagagtggacggca
accttacattatatgaagacgaaagatattaatgtaaagcctattatttctcatttttta
ccgttagaaaaaggcccggagacatttgataaattagttaacaagaaagaacgatttgat
aaagtcatgtttacgatttattag

DBGET integrated database retrieval system