KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR1274Help
Entry
SAR1274           CDS       T00182                                 

Gene name
glpF
Definition
(GenBank) putative glycerol uptake facilitator protein
  KO
K02440  glycerol uptake facilitator protein
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Brite
KEGG Orthology (KO) [BR:sar00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sar02000]
    SAR1274 (glpF)
Transporters [BR:sar02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    SAR1274 (glpF)
Ion channels [BR:sar04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   SAR1274 (glpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: CAG40277
GeneDB: SAR1274
LinkDB All DBs
Position
1338530..1339348
Genome map
AA seq 272 aa AA seqDB search
MNVYLAEFLGTAILILFGGGVCANVNLKRSAANGADWIVITAGWGLAVTMGVYAVGQFSG
AHLNPAVSLALALDGSFDWSLVPGYIVAQMLGAIVGATIVWLMYLPHWKATEEAGAKLGV
FSTAPAIKNYFANFLSEIIGTMALTLGILFIGVNKIADGLNPLIVGALIVAIGLSLGGAT
GYAINPARDLGPRIAHAILPIAGKGGSNWSYAIVPILGPIAGGLLGAVVYAVFYKHTFNI
GCAIAIVVVIITLILGYILNKSSKKGDIESIY
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtatatttagcagaattcctaggaactgcaatcttaatcctttttggtggtggc
gtttgtgccaatgtcaatttaaagagaagtgctgcgaatggtgctgattggattgtcatc
acagctggatggggattagcggttacaatgggtgtgtatgctgttggtcaattctcaggt
gcacatttaaacccagcggtgtctttagctcttgcattagacggaagttttgattggtca
ttagttcctggttatattgttgctcaaatgttaggtgcaattgtcggagcaacaattgta
tggttaatgtacttgccacattggaaagcgacagaagaagctggcgcgaaattaggtgtt
ttctctacagcaccggctattaagaattactttgccaactttttaagtgaaattatcgga
acaatggcattaactttaggtattttatttatcggtgtaaacaaaattgctgatggttta
aatcctttaattgtcggagcattaattgttgcaatcggattaagtttaggcggtgctact
ggttatgcaatcaacccagcacgtgatttaggtccgagaattgcacatgcgattttacca
atagctggcaaaggtggttcaaattggtcatatgcaatcgttcctatcttaggaccaatt
gccggtggtttattaggtgcggtagtatacgctgtattttataaacatacatttaatatt
ggttgtgcaattgcaattgttgtagttattattactttgattttaggttacattttaaat
aaatcatcaaaaaaaggtgatatcgaatcaatttactaa

DBGET integrated database retrieval system