KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR2170Help
Entry
SAR2170           CDS       T00182                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00473  D-Alanine metabolism
sar00550  Peptidoglycan biosynthesis
sar01100  Metabolic pathways
sar01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sar00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SAR2170
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAR2170
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SAR2170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sar01011]
    SAR2170
Enzymes [BR:sar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SAR2170
Peptidoglycan biosynthesis and degradation proteins [BR:sar01011]
 Precursor biosynthesis
  Amino acid ligase
   SAR2170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: CAG41151
GeneDB: SAR2170
UniProt: Q6GEZ1
LinkDB All DBs
Structure
PDB: 

Position
complement(2242427..2243497)
Genome map
AA seq 356 aa AA seqDB search
MTKENICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDWRKQNNITTEIK
STDELHLENGEALEISQLLKESSSGQPYDAVFPLLHGPNGEDGTIQGLFEVLDVPYVGNG
VLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDKLNYPVFVKPAN
LGSSIGISKCSNEVELKEGIKEAFQFDRKLVIEQGVNAREIEVAVLGNDYPEATWPGEVV
KDVAFYDYKSKYKDGKVQLQIPADLDEDVQLTLRNMALEAFKATDCSGLVRADFFVTEDN
QIYINETNAMPGFTAFSMYPKLWENMGLSYPELITKLIELAKERHQDKQKNKYKID
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaaaatatttgtatcgtttttggagggaaaagtgcagaacacgaagtatcg
attctgacagcacaaaatgtattaaatgcaatagataaagacaaatatcatgttgatatc
atttatattaccaatgatggtgattggagaaagcaaaataatattacaactgaaattaaa
tctactgatgagcttcatttagaaaatggagaggcgcttgagatttcacagctactgaaa
gaaagtagttcaggacaaccatacgatgcagtattcccattattacatggtcctaatggt
gaagatggcacgattcaagggctttttgaagtattggatgtaccatatgtaggaaatggt
gtattgtcagctgcaagttctatggacaaacttgtaatgaaacaattatttgaacatcga
gggttaccacagttaccttatattagtttcttacgttctgaatatgaaaaatatgaacat
aacattttaaaattagtaaatgataaattaaattacccagtctttgttaaacctgctaac
ttagggtcaagtataggtatcagtaaatgtagtaatgaagtggaacttaaagaaggtatt
aaagaagcattccaatttgaccgtaagcttgttattgaacaaggcgttaacgcacgtgaa
attgaagtagcagttttaggaaatgactatcctgaagcgacatggccaggtgaagtcgta
aaagatgtcgcgttttacgattacaaatcaaaatataaagatggtaaggttcaattacaa
attccagctgacttagacgaagatgttcaattaacgcttagaaatatggcattagaggca
ttcaaagcgacagattgttctggtttagtccgtgcggatttctttgtaacagaagacaac
caaatatatattaatgaaacaaatgcaatgcctggatttacggctttcagtatgtatcca
aaattatgggaaaatatgggcttatcttatccagaattgattacaaaacttatcgagctt
gctaaagaacgtcaccaggataaacagaaaaataaatacaaaattgactaa

DBGET integrated database retrieval system