KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR2191Help
Entry
SAR2191           CDS       T00182                                 

Gene name
atpD
Definition
(GenBank) ATP synthase beta chain
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00190  Oxidative phosphorylation
sar01100  Metabolic pathways
Module
sar_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:sar00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAR2191 (atpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:sar00194]
    SAR2191 (atpD)
Enzymes [BR:sar01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     SAR2191 (atpD)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     SAR2191 (atpD)
Photosynthesis proteins [BR:sar00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   SAR2191 (atpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N RsgA_GTPase AAA ATPase_2 ABC_tran NACHT NB-ARC T3SS_ATPase_C AAA_16 AAA_19 RNA_helicase AAA_7 ATPase TrwB_AAD_bind
Motif
Other DBs
NCBI-ProteinID: CAG41172
GeneDB: SAR2191
UniProt: Q6GEX2
LinkDB All DBs
Position
complement(2259958..2261370)
Genome map
AA seq 470 aa AA seqDB search
MGIGRVTQVMGPVIDVRFEHNEVPKINNALVIDVPKEEGTIQLTLEVALQLGDDVVRTIA
MDSTDGVQRGMDVKDTGKEISVPVGDETLGRVFNVLGETIDLKEEISDSVRRDPIHRQAP
AFDELSTEVQILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGIS
VFAGVGERTREGNDLYFEMSDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEYFRDEQ
GQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTTKGSVTSI
QAVFVPADDYTDPAPATAFAHLDATTNLERKLTEMGIYPAVDPLASTSRALEPSIVGQEH
YEVARDVQSTLQKYRELQDIIAILGMDELSDEDKQTVERARRIQFFLSQNFHVAEQFTGQ
KGSYVPVKTTVANFKDILDGKYDHIPEDAFRLVGSMDDVIAKAKDMGVEV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgggaattggccgtgtaactcaagttatgggtcctgtaattgatgttcgatttgaacat
aacgaagttcctaaaattaataacgccttggttattgatgtgcctaaagaagaaggtaca
atacaactaacattagaagttgcgctgcaattaggtgacgacgttgttcgtacaattgcg
atggattcaactgatggtgtccaaagaggcatggatgtaaaagatacaggcaaagaaatt
agtgtacctgttggtgatgaaacattaggtcgtgtatttaatgtactaggtgaaacaatt
gaccttaaagaagaaattagtgattctgttcgccgcgatcctatccatcgtcaagcacca
gcattcgatgaactttcaacagaagttcaaattttagaaacaggtattaaagtagtagat
ttactagcaccttatattaaaggtggtaaaatcggattgttcggtggtgccggtgtaggt
aaaacagtattaatccaagaattaattaacaacatcgctcaagagcacggtggtatttct
gtattcgccggtgtaggtgaacgtactcgtgaaggtaacgatttatacttcgaaatgagt
gatagtggtgtaattaagaaaacagccatggtattcgggcaaatgaatgagccacctggt
gcacgtatgcgtgttgcattatctggtttaacaatggctgaatatttccgtgacgaacaa
ggtcaagacgtattattattcatcgataacattttcagatttacacaagctggttctgag
gtatctgcattattaggtcgtatgccttctgcagtaggttaccaaccaacacttgctact
gaaatgggacaattacaagaacgtattacgtctacaacaaaaggatcagtaacttctatt
caagcggtattcgtacctgccgatgactatactgacccagcgccagcgacagcgtttgcc
catttagatgcaactacaaacttagaacgtaaattaactgaaatgggtatttatccagcc
gtggatccattagcgtctacatcaagagcattggaaccatcaattgtaggtcaagaacat
tatgaagtagctcgtgatgtacaatcaacacttcaaaaataccgtgaattacaagatatc
attgctatcttaggtatggacgaattatctgatgaagataaacaaacagttgaacgcgca
cgtagaattcaattcttcttatctcaaaacttccacgtagcggaacaatttactggtcaa
aaaggttcttatgtacctgttaagacaacagttgcaaactttaaagatatcttagatggt
aaatatgaccatattccagaagatgcattccgtttagttggtagcatggatgatgttatt
gcaaaagctaaagatatgggtgttgaagtataa

DBGET integrated database retrieval system