KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS0880Help
Entry
SAS0880           CDS       T00183                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
sas00061  Fatty acid biosynthesis
sas00780  Biotin metabolism
sas01100  Metabolic pathways
sas01130  Biosynthesis of antibiotics
sas01212  Fatty acid metabolism
Module
sas_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SAS0880
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SAS0880
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SAS0880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sas01004]
    SAS0880
Enzymes [BR:sas01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SAS0880
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SAS0880
Lipid biosynthesis proteins [BR:sas01004]
 Fatty acid synthase
  Component type
   SAS0880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: CAG42655
GeneDB: SAS0880
LinkDB All DBs
Structure
PDB: 

Position
967972..968742
Genome map
AA seq 256 aa AA seqDB search
MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
VTGENIHVDSGFHAIK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatcttgaaaacaaaacatatgtcattatgggaatcgctaataagcgtagtatt
gcttttggtgtcgctaaagttttagatcaattaggtgctaaattagtatttacttaccgt
aaagaacgtagccgtaaagagcttgaaaaattattagaacaattaaatcaaccagaagcg
cacttatatcaaattgatgttcaaagcgatgaagaggttattaatggttttgagcaaatt
ggtaaagatgttggcaatattgatggtgtatatcattcaatcgcatttgctaatatggaa
gacttacgcggacgcttttctgaaacttcacgtgaaggtttcttgttagctcaagacatt
agttcttactcactaactatcgttgctcatgaagctaaaaaattaatgccagaaggtggt
agcattgttgcaacaacatatttaggtggcgaattcgcagttcaaaactataatgtgatg
ggtgttgctaaagcgagcttagaagcaaatgttaaatatttagcattagacttaggtcca
gataatattcgcgttaatgcaatttcagctggtccaatccgtacattaagtgcaaaaggt
gtgggtggtttcaatacaattcttaaagaaatcgaagagcgtgcacctttaaaacgtaat
gttgatcaagtagaagtaggtaaaactgcggcttacttattaagtgatttatcaagtggc
gttacaggtgaaaatattcatgtagatagcggattccacgcaattaaataa

DBGET integrated database retrieval system