KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS1987Help
Entry
SAS1987           CDS       T00183                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
sas00473  D-Alanine metabolism
sas00550  Peptidoglycan biosynthesis
sas01100  Metabolic pathways
sas01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SAS1987
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAS1987
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SAS1987
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sas01011]
    SAS1987
Enzymes [BR:sas01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SAS1987
Peptidoglycan biosynthesis and degradation proteins [BR:sas01011]
 Precursor biosynthesis
  Amino acid ligase
   SAS1987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 DUF2487
Motif
Other DBs
NCBI-ProteinID: CAG43794
GeneDB: SAS1987
UniProt: Q6G7M7
LinkDB All DBs
Structure
PDB: 

Position
complement(2145146..2146216)
Genome map
AA seq 356 aa AA seqDB search
MTKENICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDWRKQNNITAEII
STDELHLENGEALEISQLLKESSSGQPYDAVFPLLHGPNGEDGTIQGLFEVLDVPYVGNG
VLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDKLNYPVFVKPAN
LGSSVGISKCNNEAELKEGIKEAFQFDRKLVIEQGVNAREIEVAVLGNDYPEATWPGEVV
KDVAFYDYKSKYKDGKVQLQIPADLDEDVQLTLRNMALEAFKATDCSGLVRADFFVTEDN
QIYINETNAMPGFTAFSMYPKLWENMGLSYPELITKLIELAKERHQDKQKNKYKID
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaaaatatttgtatcgtttttggagggaaaagtgcagaacacgaagtatcg
attctgacagcacaaaatgtattaaatgcaatagataaagacaaatatcatgttgatatc
atttatattaccaatgatggtgattggagaaagcaaaataatattacagctgaaattata
tctactgatgagcttcatttagaaaatggagaggcgcttgagatttcacagctattgaaa
gaaagtagttcaggacaaccatacgatgcagtattcccattattacatggtcctaatggt
gaagatggaacgattcaaggactttttgaagttttggatgtaccatatgtaggaaatggt
gtattgtcagctgcaagttctatggacaaacttgtaatgaaacaattatttgaacatcga
gggttaccacagttaccttatattagtttcttacgttctgaatatgaaaaatatgaacat
aacattttaaaattagtaaatgataaattaaattacccagtctttgttaaacctgctaac
ttagggtcaagtgtaggtatcagtaaatgtaataatgaagcggaacttaaagaaggtatt
aaagaagcattccaatttgaccgtaagcttgttatagaacaaggcgttaacgcacgtgaa
attgaagtagcagttttaggaaatgactatcctgaagcgacatggccaggtgaagtcgta
aaagatgtcgcgttttacgattacaaatcaaaatataaagatggtaaggttcaattacaa
attccagctgacttagacgaagatgttcaattaacgcttagaaatatggcattagaggca
ttcaaagcgacagattgttctggtttagtccgtgcagatttctttgtaacagaagacaac
caaatatatattaatgaaacaaatgcaatgcctggatttacggctttcagtatgtatcca
aagttatgggaaaatatgggcttatcttatccagaactgattacaaaacttatcgagctt
gctaaagaacgtcaccaggataaacagaaaaataaatacaaaattgactaa

DBGET integrated database retrieval system