KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS2025Help
Entry
SAS2025           CDS       T00183                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
sas00010  Glycolysis / Gluconeogenesis
sas00053  Ascorbate and aldarate metabolism
sas00071  Fatty acid degradation
sas00280  Valine, leucine and isoleucine degradation
sas00310  Lysine degradation
sas00330  Arginine and proline metabolism
sas00340  Histidine metabolism
sas00380  Tryptophan metabolism
sas00410  beta-Alanine metabolism
sas00561  Glycerolipid metabolism
sas00620  Pyruvate metabolism
sas00625  Chloroalkane and chloroalkene degradation
sas01100  Metabolic pathways
sas01110  Biosynthesis of secondary metabolites
sas01120  Microbial metabolism in diverse environments
sas01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAS2025
   00053 Ascorbate and aldarate metabolism
    SAS2025
   00620 Pyruvate metabolism
    SAS2025
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAS2025
   00561 Glycerolipid metabolism
    SAS2025
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAS2025
   00310 Lysine degradation
    SAS2025
   00330 Arginine and proline metabolism
    SAS2025
   00340 Histidine metabolism
    SAS2025
   00380 Tryptophan metabolism
    SAS2025
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAS2025
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAS2025
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAS2025
Enzymes [BR:sas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAS2025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF4262
Motif
Other DBs
NCBI-ProteinID: CAG43833
GeneDB: SAS2025
UniProt: Q6G7I8
LinkDB All DBs
Structure
PDB: 

Position
complement(2178021..2179448)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADNVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPKKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggcaat
aaagctgatgttgataaagctgtcgaggcggcagacaatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcgttattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgaattaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggcttaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggcgttgggaatcctttatctgagcatcctaaagtacgcatgatgtca
tttacaggatcaggccctactggttctaaaattatggaaaaagctgctaaagattttaaa
aaggtatcattagagcttggtggcaaatcaccatacatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgagttttagtgcctaaaaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtggataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcagttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gatttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggatattttaaataa

DBGET integrated database retrieval system