KEGG   Salmo salar (Atlantic salmon): 100136351
Entry
100136351         CDS       T04363                                 

Gene name
raf1, raf1c
Definition
(RefSeq) Raf-1 proto-oncogene, serine/threonine kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04270  Vascular smooth muscle contraction
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100136351 (raf1)
   04012 ErbB signaling pathway
    100136351 (raf1)
   04370 VEGF signaling pathway
    100136351 (raf1)
   04371 Apelin signaling pathway
    100136351 (raf1)
   04068 FoxO signaling pathway
    100136351 (raf1)
   04150 mTOR signaling pathway
    100136351 (raf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100136351 (raf1)
  09143 Cell growth and death
   04210 Apoptosis
    100136351 (raf1)
   04218 Cellular senescence
    100136351 (raf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100136351 (raf1)
   04540 Gap junction
    100136351 (raf1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100136351 (raf1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100136351 (raf1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100136351 (raf1)
   04912 GnRH signaling pathway
    100136351 (raf1)
   04914 Progesterone-mediated oocyte maturation
    100136351 (raf1)
   04916 Melanogenesis
    100136351 (raf1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100136351 (raf1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100136351 (raf1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    100136351 (raf1)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100136351 (raf1)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100136351 (raf1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 Kdo zf-RING_2
Other DBs
NCBI-GeneID: 100136351
NCBI-ProteinID: NP_001116996
UniProt: Q2V2G8
LinkDB
Position
ssa22
AA seq 637 aa
MEHIQGAWKTLSNGLGLKDSGFDDSCMSPTIMKGFPYQRRSSDDGKMADPKTSSTIRVFL
PNKQCTVVNARPGMTLHNCLIKAMKVXGLQPECCAVFRLHSAQSRKSRMDWNTDATSLIG
EELLVDVLDHVPLTTHNFVRNTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTM
CVDWSNIRQLLLFPTPGETGGPSLPPLTSRRLRDSLSRFPVRHSTLHAFNQAPGSVLGAG
PAVLSHRLRSTSTPNVHMVSTTLPLDSTAFKDAMRSHESESPSDLSLTCWSQSVSSRAPA
PMHKERAGSSNTQVKNRMRPRXKRASSYYWEIEASEVVLQNRIGSGSFGTVYKGKWHGDV
AVKILXVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTEDNLAIVTQWCDGSSLYHH
LHIQETNLQMFQLMDIARQTAQGMNYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATV
KARWSGSYQVEQPSGSILWMAPEVIRMQDNNPYSFQSDVYSYGVVLYELMTGELPYSMIA
TRDQIIFMVGRGSLFPELSKLYKNCPKAMKRLVADCIKKSKDDRPLFPQILSSIELLQHA
LPRINRSTSEPSLHRATHTEDVNICPLTYTRQPTAVF
NT seq 1914 nt   +upstreamnt  +downstreamnt
atggagcacatccagggagcctggaagaccctgagtaacggattgggcctgaaggactca
gggtttgatgactcctgcatgtctcccaccatcatgaagggattcccctaccagagacgg
tcctcagacgacggcaagatggcagaccctaaaaccagcagcaccattagagtgttcctg
cccaacaaacagtgcactgtggtgaacgcgaggccaggtatgaccctccataactgtctg
attaaagctatgaaggtacnaggcctccagccagagtgctgtgctgtgttcaggctacac
tctgcacagagcaggaagtccaggatggactggaacacggacgctacctcgctgataggg
gaggagctactggtggacgttctagaccacgtccctctgacaacacacaactttgtccga
aatactttcctgaagctggcgttctgcgacatctgtcagaagttcctgctcaatgggttc
cgctgccagacgtgtggctataagttccatgaacactgcagcaccaaggttcccacaatg
tgtgttgactggagcaacatacgacagctgctcctgttccctacccctggagagactggt
ggtccatctctccctcctctaacatcacgacgtctgagggactcgctctccagatttcct
gtcagacactctaccctccatgccttcaaccaggcccctgggtctgtactgggggctgga
ccggctgtgctctcccaccgactgagatccacatccacccccaacgtacacatggtcagc
accaccctgccgctggacagcaccgccttcaaggatgccatgagaagtcatgaatctgag
agcccttccgacctcagtctaacatgctggtcccagtccgtctcgtcccgagcgccagcc
cccatgcacaaggagagggctggctcctctaacactcaggtgaaaaacagaatgcgtccc
agaganaagagagcttcctcttactactgggagatcgaggccagtgaggtggttctccag
aacaggatcggctctggctcgttcgggacagtctacaaagggaagtggcacggtgatgta
gcagtgaagatcctgaangtggtagatccaactccagaacaattccaggccttcaggaac
gaagtggctgtcctcaggaagacgcgtcacgtcaacatcctgctcttcatgggctatatg
actgaggacaacctggcgatagtgacccagtggtgtgacggctccagcctttaccaccac
cttcacatccaagagaccaacctacagatgttccagctgatggacatcgccaggcagact
gcacagggcatgaattatctacatgctaagaatatcattcatcgggacatgaaatccaac
aacatcttcctccatgagggccttacagtgaagatcggggactttggtctagccacggtg
aaggctcgctggagtggttcatatcaggtggagcaaccctctgggtccatactatggatg
gctccagaggtgatccgcatgcaggacaacaacccctatagtttccagtctgacgtctac
tcatacggtgtggttctgtatgaactgatgactggagaactgccttacagcatgatcgct
actcgagaccagatcatcttcatggtgggtcgtggctccctgtttccagagctgagtaag
ctgtataaaaactgtcctaaagccatgaagaggctggtggccgactgcatcaagaagtcc
aaagacgacaggccactcttccctcagatcctgtcgtccattgagttgctgcagcatgct
ctacctagaatcaaccgcagcacctccgagccgtcgctccacagagcaacacacactgag
gacgttaacatctgccctttgacctacacacgccaacctactgctgtcttctag

KEGG   Salmo salar (Atlantic salmon): 106566757
Entry
106566757         CDS       T04363                                 

Gene name
RAF1a
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase-like
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04270  Vascular smooth muscle contraction
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106566757 (RAF1a)
   04012 ErbB signaling pathway
    106566757 (RAF1a)
   04370 VEGF signaling pathway
    106566757 (RAF1a)
   04371 Apelin signaling pathway
    106566757 (RAF1a)
   04068 FoxO signaling pathway
    106566757 (RAF1a)
   04150 mTOR signaling pathway
    106566757 (RAF1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106566757 (RAF1a)
  09143 Cell growth and death
   04210 Apoptosis
    106566757 (RAF1a)
   04218 Cellular senescence
    106566757 (RAF1a)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106566757 (RAF1a)
   04540 Gap junction
    106566757 (RAF1a)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106566757 (RAF1a)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106566757 (RAF1a)
  09152 Endocrine system
   04910 Insulin signaling pathway
    106566757 (RAF1a)
   04912 GnRH signaling pathway
    106566757 (RAF1a)
   04914 Progesterone-mediated oocyte maturation
    106566757 (RAF1a)
   04916 Melanogenesis
    106566757 (RAF1a)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106566757 (RAF1a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106566757 (RAF1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106566757 (RAF1a)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106566757 (RAF1a)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   106566757 (RAF1a)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 zf-RING_2
Other DBs
NCBI-GeneID: 106566757
NCBI-ProteinID: XP_013990593
UniProt: A0A1S3LI20
LinkDB
Position
ssa13
AA seq 684 aa
MEHLQGAWKTLSNGFGMKDSVFEGPCLSPTMVQDFPSQRRSSDDSKIPDSKTSSTIRVYL
PNQQRTVVNVRPGMTLHSCLIKALKVRGLQPECCAVFRLHPGQRSKKSRMDWNTDSTSLI
GEELLVKVLDHVPLTTHNFVRKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPT
MCVDWSNIRQLLLFPTPGESGGPSLPPLTSRRMRESLSRLPSSSLHRCSTPHAFNYTAPY
PPTGGALSQRQRSTSTPNVHIVSTTMPVDSSMIELDVLNTSPSSWCRCFWLKRRVGIIRF
SNSFVEATSESPDKEAMRNHEAMRNHDSGGSSPSQSPTGWSQSQSNTPAPDRRERAPSFN
TQEKHKIHPRDKRDSSYYWEIEASEVVLHSCIGSGSFGTVYKGKWHGDVAVKILKVIDPT
PEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETNFQMF
QLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKARWSGSHQVE
QPSGSILWMAPEVIRMQDNMPYSFQSDVYSYGVVLHELMTGELPYSQIANRDQIIFMVGR
GYLSPDLSKLYKSCPKAMKRLVADCIKKIKDERPLFPQILSSIELLQHSLPKINRSASEP
SLHRASHTEDINAFTSTYSRLPVF
NT seq 2055 nt   +upstreamnt  +downstreamnt
atggagcacctccagggagcatggaagaccctgagcaatggctttgggatgaaggactct
gtgttcgagggtccttgcctttccccgaccatggtgcaggacttcccctcccagcgccgc
tcctccgacgacagtaagatccccgactccaagaccagcagcaccatccgcgtctacctc
cccaaccagcagcgcacagtggtgaatgtgaggccaggtatgaccctgcacagctgcctg
atcaaagcgctgaaggtgcggggcctgcaaccggagtgctgtgctgtcttcagactgcac
ccaggacagaggagtaaaaagtcacgtatggattggaataccgactctacctcactaatt
ggggaagaactgctggtgaaagttttagatcatgtccccttgacgacgcacaactttgtt
cggaaaacatttctgaagttggccttctgcgatatatgccagaagttccttttgaacggt
ttccgttgccaaacatgcggctacaaattccatgagcattgcagcaccaaagtgcccacg
atgtgtgtggattggagcaacatcagacagctcctgttgttcccgacaccaggtgaaagt
gggggtccatctcttcctcctcttacttctcggcgaatgagagaatcgctgtcccgactc
cccagcagctctctgcaccgctgctccacccctcacgccttcaactacacggccccctac
ccacccacggggggcgctctgtcccagaggcagcgctccacctccacgcccaacgtccac
atagtcagcaccaccatgcccgtcgacagcagcatgatcgagctagatgttctgaatacc
tcccctagctcatggtgcaggtgtttctggctgaagaggagagtaggtatcattcgcttc
tccaattcttttgttgaggcgacgtcagagagcccagacaaggaagcaatgcgtaatcat
gaagcaatgcgtaatcatgactcaggcgggagttcccccagccagagtcccacaggctgg
tcccagtcccagtctaacaccccagctccagacagacgagagagggctccttcattcaac
actcaggagaaacacaaaatacatccgagggacaagcgggactccagttactactgggag
attgaggccagtgaagtggtgctacactcctgtatcggctcaggctccttcggaacggta
tacaaagggaaatggcacggtgacgtagcggtgaagatcctaaaggtgattgaccccacg
ccagagcagttccaggccttcagaaacgaggtggctgtccttaggaaaacgcggcacgtc
aacatcctgttgttcatgggctacatgacgaaggacaacctggccatcgtgacccagtgg
tgtgagggcagcagcctctacaaacaccttcacgtccaggagaccaacttccagatgttc
cagcttatagacatcgccagacagacagctcagggcatggactatttgcacgccaaaaac
atcatccaccgggacatgaagtcaaacaatatcttcctacatgagggcctgacggtgaag
ataggagactttggtctggccacggtcaaggccaggtggagtggttctcaccaggtggag
caaccctcagggtccatactgtggatggctcctgaggttatccgtatgcaggacaacatg
ccctatagtttccagtctgacgtgtactcctacggtgttgtcctccatgagctgatgacg
ggagagctgccatactcacagatagccaacagagaccagatcatcttcatggtgggccgg
gggtacctgtctccagacctcagtaagctttataagagctgtcctaaggccatgaagagg
ctggtggccgactgcatcaagaaaatcaaggacgagaggccactgttcccccagatcctg
tcgtcaattgagctgctccagcactccctgcctaagatcaaccgcagtgcctcagaaccc
tccctgcacagagcctcccacaccgaagacattaacgccttcacttccacctatagcaga
ctgcctgtgttctag

KEGG   Salmo salar (Atlantic salmon): 106571905
Entry
106571905         CDS       T04363                                 

Gene name
RAF1b
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase-like
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04270  Vascular smooth muscle contraction
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106571905 (RAF1b)
   04012 ErbB signaling pathway
    106571905 (RAF1b)
   04370 VEGF signaling pathway
    106571905 (RAF1b)
   04371 Apelin signaling pathway
    106571905 (RAF1b)
   04068 FoxO signaling pathway
    106571905 (RAF1b)
   04150 mTOR signaling pathway
    106571905 (RAF1b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106571905 (RAF1b)
  09143 Cell growth and death
   04210 Apoptosis
    106571905 (RAF1b)
   04218 Cellular senescence
    106571905 (RAF1b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106571905 (RAF1b)
   04540 Gap junction
    106571905 (RAF1b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106571905 (RAF1b)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106571905 (RAF1b)
  09152 Endocrine system
   04910 Insulin signaling pathway
    106571905 (RAF1b)
   04912 GnRH signaling pathway
    106571905 (RAF1b)
   04914 Progesterone-mediated oocyte maturation
    106571905 (RAF1b)
   04916 Melanogenesis
    106571905 (RAF1b)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106571905 (RAF1b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106571905 (RAF1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106571905 (RAF1b)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106571905 (RAF1b)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   106571905 (RAF1b)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 zf-RING_2
Other DBs
NCBI-GeneID: 106571905
NCBI-ProteinID: XP_014000929
UniProt: A0A1S3MCY0
LinkDB
Position
ssa15
AA seq 682 aa
MEHLQGAWKTLSNGFGMKDSVFEGPCLSPTMVQGFPYQRRSSDDGKIPDSKTSSTIRVYL
PNQQRTVVNVRPGMTLHSCLIKALKVRGLQPECCAVFRLHPGQRSKKSRMDWNTDSTSLI
GEELLVEVLDHVPLTTHNFVRKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPT
MCVDWSNIRQLLLFPTPGESGGPSLPPLTSRRMRESRFPSSSLHRYSTPHAFNYTAPYPP
TAGTLSQRQRSTSTPNVHMVSTTLPVDSSMIELDCLNAYPSSWCRRFWLKRRVGIVRFSN
SFLEATSESPAKEAMRNHEAMRNHDSDGSSPSQSPTSWSQSQSKTPAPDRRERAPSFNTQ
EKHKIRPRDKRDSSYYWEIEASEVVLHSRIGSGSFGTVYKGKWHGDVAVKILKVIDPTPE
QFQAFRNEVAVLRKTRHVNILLFMGYMTEDNLAIVTQWCEGSSLYKHLHVQETNLQMFQL
IDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKARWSGSHQVEQP
SGSILWMAPEVIRMQDNMPYSFQSDVYSYGVVLYELMTGELPYSQIANRDQIIFMVGRGY
MSPDLSKLYKSCPKAMKRLVADCIKKIKDERPLFPQILSSIELLQHSLPKINRSASEPSL
HRASHTEDINVFTSTYSRLPVF
NT seq 2049 nt   +upstreamnt  +downstreamnt
atggagcacctccagggagcgtggaagaccctgagcaacggctttggaatgaaggactct
gtgttcgagggcccctgcctctcccccaccatggttcagggctttccataccagcgccgc
tcctcagacgacggcaagatccctgactctaagaccagcagcaccatccgagtctacctc
cccaaccagcagcgcaccgtggtgaacgtgaggccgggtatgaccctgcacagctgcctg
atcaaagcgctgaaggtgcggggtctgcagccggagtgctgtgctgtcttcagactgcac
ccaggacagaggagtaaaaagtcacgtatggattggaataccgactccacctcactaatt
ggggaagaactgctggtggaagtgttagatcatgtccccttgacgacgcacaactttgtt
cggaaaacatttcttaagttagccttctgcgatatatgccagaagttccttttgaacggt
ttccgttgccaaacatgcggctacaaattccatgagcattgcagcaccaaagtgcccacg
atgtgtgtggattggagcaacatcagacagctcctgttgttccctacaccaggtgaaagt
gggggtccatctcttcctcctcttacatctcgacgaatgagagaatcccgatttcctagc
agttctctgcaccgctactcaacccctcacgccttcaactacacagccccctacccaccc
acagcgggcactctgtcccagagacagcgctccacctccacgcccaacgtccacatggtc
agcaccaccctgcccgtcgacagcagcatgattgagctagattgcctgaatgcctaccct
agctcctggtgcaggcgcttctggctgaagaggagagtaggtattgttcgcttctccaac
tcttttcttgaggcgacttcagagagcccagccaaggaggcaatgcgtaatcatgaagca
atgcgtaatcatgactcagacgggagttcccccagccagagtcccacaagctggtcccag
tcacagtctaaaaccccagcgccagacagacgagaaagggctccgtcgttcaacactcaa
gagaaacacaaaattcgtccgagggacaagcgagactctagttactactgggagattgag
gccagtgaagtggtgctgcactcccgtattggctcaggctccttcggaacggtatacaaa
gggaaatggcacggtgacgtagcagtgaagatcctaaaggtgattgaccccacaccggaa
cagttccaggcctttagaaacgaggtggctgtgctaaggaaaacacgacacgtcaacatc
ctattgttcatgggctacatgacggaggacaacctggccatcgtgacccagtggtgtgaa
ggcagcagcctctataaacacctccacgtccaggagaccaacttacagatgttccagctc
atagacatcgccaggcagacagctcagggcatggactatttgcacgccaaaaacatcatc
caccgggacatgaaatcaaacaatatcttcctacacgagggcctgacggtgaagattggc
gactttggtctggccacagtcaaagccaggtggagtggttctcaccaggtggagcaacct
tcagggtccatactgtggatggctccagaggttatccggatgcaggacaatatgccctat
agtttccagtcagacgtgtactcttacggtgttgtcctctatgagctgatgacaggagag
ctgccatactcacagatagccaacagagaccagatcatcttcatggtgggtcgggggtac
atgtctccagacctcagtaagctttataagagctgccccaaagccatgaagaggctggtg
gctgactgcatcaagaaaatcaaagacgagaggccgctgtttccccagatcctgtcgtcc
attgagctgctccagcactccctgcctaagatcaaccgcagtgcctcagaaccctccctg
cacagagcctcccacaccgaggacatcaacgtcttcacatcaacctatagcaggctgcct
gtgttctag

DBGET integrated database retrieval system