KEGG   Salmo salar (Atlantic salmon): 100136358
Entry
100136358         CDS       T04363                                 

Gene name
nos2, inos
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00220  Arginine biosynthesis
sasa00330  Arginine and proline metabolism
sasa01100  Metabolic pathways
sasa04020  Calcium signaling pathway
sasa04146  Peroxisome
sasa04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100136358 (nos2)
   00330 Arginine and proline metabolism
    100136358 (nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100136358 (nos2)
   04020 Calcium signaling pathway
    100136358 (nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100136358 (nos2)
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100136358 (nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6 Fer4_11
Other DBs
NCBI-GeneID: 100136358
NCBI-ProteinID: XP_014070450
UniProt: A0A1S3T1H9
LinkDB
Position
ssa09
AA seq 1100 aa
MTFPNMIMNCIYFTIMKMKLLQDDETKMSHQTKPNKWETRANRCPFSIPVRNVKDGSSRK
DMLHHQAVKNQPCTSKVCEGSVMTPKALLRGPKYATLEILPQAIDLINQYYKSFKIPKIE
HHLARLEEITMEIDSTGTYQLTFEELAFGARQAWRNAPRCIGRIQWSNLQLFDARKCKTT
QDMFQFLCEHLQFATNGGNLRSAITVFPQRKEDGHDFRVWNGQLLKYAGYQMPDGSIQGD
PSSVEFTKICIQLGWKPQYGLFDVLPLVLQVNGEDPDLYEIPPHLILEVSMEHPQHKWFQ
DLGLKWYALPAVSNMLMEIGGLEFPACPFNGWYMGTEIGVRDFCDYQRYNILEEVGRRMG
LETHKLSSLWKDQALVTINVAVIYSFQKNKVTITDHHSAAESFMKHLETEFRLRGGCPAD
WAWLVPPMSGSLTPVFHQEMVNYILSPFFYYQPDPWTTHVWRNGEMCLKKQQISFKAVAR
AALFSSTLMSKVLANRVRCTVLYATETGKSQTLAQRLNSMLNCAFNSRLLCMEDYNFSDM
EQESLLVVVTSTFGNGDSPGNGESFKKQLFSLQYLRNKLRYCVFGLGSRMYPQFCAFAHA
VDAKLEELGAERVTPTGEGDELNGQEEAFSSWALTALKDAYKEFNIQGQLSLQLPGAERF
FEAWDPLRYRVALESCPQDRITALSAIHSKTVFPMKLKSKHNLQSPHSSRSTILVELERE
RSAEVMNFAPGDHVGVFPGNLPQLVAGILKFLPQPPQTNQYLRLEYRSDTCRDDEKNWQT
VGRIPACPLSQALTYFLDVTTPPCQNLLHKLSQLAKQDGHRQRLLTLAKDSKEYTTWKMF
RVPNFLEVLEEFPSLEPSAAFLLSQLPLLKPRLYSISSSPQLHPNELHLTLTVLNYHTQD
GQGPLHHGVCSTWLDTIKKGDLVPCFIYSSGGFHLPAEPSTPVILVGAGSGIAPFRSFWQ
HRLHDMKHPEFSGSPMSLVFGCQSSETDHLYKEETLEMRRRGVLKSVTSAYSRQPGHPKV
YVQDVLRERMAEEVLNVLHQKEGHFYVCGGVNMAQGVTLAVQEILSSQLGITLTQAGEYL
AQLKIQKRYHEDIFGAQFQK
NT seq 3303 nt   +upstreamnt  +downstreamnt
atgacatttccaaatatgataatgaactgcatttattttacaattatgaagatgaagctg
cttcaggatgatgaaaccaaaatgtctcaccagactaaaccaaataagtgggaaacgaga
gccaacaggtgtccgttttcgatacctgtgcgtaacgtgaaggatggctcaagtcgcaaa
gacatgctgcaccaccaggcagtcaagaaccaaccatgcacatcaaaagtttgtgaaggt
tctgtcatgactccgaaggctcttctgcgcggtcccaaatatgctactcttgaaatccta
cctcaggctatcgacctaatcaaccaatactacaagtccttcaaaatccccaaaattgaa
caccacctcgccagattggaggaaattactatggagatagattccacaggaacctatcaa
ttgacttttgaggaattagcgtttggtgctcggcaagcatggaggaacgccccaagatgc
atcggcaggattcagtggtccaatttacaactgtttgatgccagaaagtgcaagactact
caggatatgttccagtttctgtgcgaacacttacagtttgccacaaatggaggaaaccta
aggtctgcgattaccgtctttcctcagagaaaggaagacgggcatgatttccgggtgtgg
aacggccagttgttgaagtatgcaggttaccaaatgcctgatggcagtatccagggagac
ccatccagtgtagaattcactaagatctgtatccagcttggatggaaacctcaatacggc
ctcttcgatgtgttgccgctagtcctacaggtcaatggggaggacccagacctttatgaa
atccctccacacctgatcttggaggtttccatggaacacccccagcataagtggttccaa
gacctaggactgaagtggtatgctctgcctgcggtgtccaacatgctgatggagattggt
ggacttgaattcccagcctgtccctttaatggctggtacatgggcactgagattggcgtg
agggatttctgtgactatcagcgttataacatcttggaggaagtgggtcgcaggatgggc
ctggagacacacaagctgtcctcactgtggaaggaccaggccttggtgaccatcaatgtt
gcagtcatatacagtttccagaagaacaaggtaaccatcacagaccaccactctgcagct
gagtccttcatgaagcacttggagacagagttccggctgcgcggcggctgccctgcagac
tgggcctggctggttcctcccatgtctggctcccttacccccgtcttccaccaggagatg
gtcaactacatcctctctcccttcttctactaccagcctgacccctggacgacccatgtc
tggagaaatggagagatgtgcctgaagaagcaacagatcagcttcaaagcggtggccagg
gcggcgctcttttcttcaaccctcatgagcaaagtgctggctaacagggtgcgttgcact
gtcctgtatgctactgaaacagggaaatcacagacattggcccagagactgaactccatg
ctaaactgtgccttcaactccaggttgctctgtatggaggactataacttcagtgacatg
gaacaggagagccttctggttgtggtaactagcacctttgggaatggagactcccctgga
aatggagagagttttaagaaacagcttttctccttgcagtatctcaggaacaagttaagg
tactgtgtgtttgggctgggctcgaggatgtacccacagttctgtgcattcgcccatgcc
gtggatgccaagctggaggagctgggggcagagcgggtgacgcccactggagagggggat
gaactgaacggacaggaggaggccttctcttcctgggctctcaccgctctcaaggatgct
tataaggagttcaacatccagggacagctgagtctgcagctccctggggcagagcgattc
ttcgaggcctgggacccactgagataccgcgtagcactggagagctgcccccaggaccgc
atcacagcactttcagccattcactctaaaactgtcttccctatgaaactgaagagcaaa
cataatctacagagcccccattcaagccggtccaccattttggtggagttggagagggag
agaagtgcagaggtcatgaactttgctccaggagaccatgttggtgttttcccagggaat
ctccctcaactggtggctggcatcctaaagttccttccccaaccaccccaaaccaaccag
tacctacgactggaataccgttctgacacctgccgagatgatgagaaaaactggcagact
gtcggacgcatcccagcatgccctttgtctcaggcactcacctacttcctggatgtgacc
acgcccccctgtcaaaacctcctccacaagctctctcagttggcgaaacaggacgggcac
cgccagcgtctactgaccttggccaaggactctaaggagtacacgacctggaagatgttc
cgtgttcccaacttcctggaagtcctggaggagttcccgtctttagaaccctctgcagct
ttcctcctcagccagctgcctctgctcaagccccgcctctactccatcagctcctcccct
cagctccaccccaacgagctacatctcactctgacagtgctcaactatcacacacaagat
ggacagggtcctcttcaccacggggtctgcagcacctggctggataccattaagaaagga
gacctggtaccatgttttatctacagttcaggtgggttccacctcccagcagagcccagc
actccagtcattctggtgggggctggcagtggcatcgcgcccttccgaagcttctggcaa
caccggctacacgacatgaaacacccagagttctctggaagtcctatgagcctggtgttt
ggctgccagagttcggagactgaccatttatacaaagaggagacactggagatgagaagg
cgaggggtcctgaagagtgttacctccgcatattcccgccagccaggtcacccaaaggtc
tatgtccaggatgtcctgagggagaggatggcagaggaggtgctgaatgtgttgcaccag
aaggagggccacttctatgtgtgtggtggtgtgaacatggcccagggagttactctagca
gtacaggagattctgagcagccagcttggcatcaccctcacccaggcaggagaatacctg
gcccaactaaagatccagaagaggtaccatgaggacatttttggagcccagtttcagaag
tga

DBGET integrated database retrieval system