KEGG   Salmo salar (Atlantic salmon): 100136454Help
Entry
100136454         CDS       T04363                                 

Gene name
sod1, SODC
Definition
(RefSeq) superoxide dismutase 1, soluble
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100136454 (sod1)
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100136454 (sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 100136454
NCBI-ProteinID: NP_001117059
UniProt: Q3ZLR1
LinkDB All DBs
Position
ssa11
AA seq 154 aa AA seqDB search
MALKAVCVLKGTGEVTGTVFFEQEGDGAPVKLTGEIAGLTPGEHGFHVHAFGDNTNGCMS
AGPHFNPHNHTHGGPTDTVRHVGDLGNVTAAADSVAKINIQDEILSLAGPHSIIGRTMVI
HEKADDLGKGDNEESRKTGNAGSRLACGVIGIAQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcactgaaggctgtttgcgtgctaaaaggaaccggtgaagttaccgggaccgtattc
tttgagcaggagggtgacggtgctccagtgaagctgacgggagagatcgcaggtctgacc
ccgggggaacatggcttccacgtccatgcctttggagacaacaccaacggctgtatgagt
gccggaccccacttcaacccccacaaccatacccacggaggacccactgacactgtccgg
cacgtaggggaccttggcaacgtgactgcagcagctgacagtgtggctaagatcaacatt
caggatgagatactgtctctcgctggaccccactctatcatcggcaggaccatggtgatc
catgagaaggctgatgatctgggaaaaggagacaacgaggagagtcggaagactggcaac
gctggcagtcgcctggcctgtggagttattggcattgcccaataa

DBGET integrated database retrieval system