KEGG   Salmo salar (Atlantic salmon): 100136478Help
Entry
100136478         CDS       T04363                                 

Definition
(RefSeq) alpha amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00500  Starch and sucrose metabolism
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100136478
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100136478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 100136478
NCBI-ProteinID: NP_001117074
UniProt: A0SEG1
LinkDB All DBs
Position
ssa03
AA seq 505 aa AA seqDB search
MKYLVLLTLLGLSQAYHNPHAKHGRQAIVHLFEWKWNDIAAECERFLAPKGYAGVQISPP
AESILLTSPWRPWWERYQPISYNLCSRSGNENELRDMITRCNNVGVNIYVDAVINHMCGA
GGGEGTHSTCGTYFNAKKMDFPSIPFSSFDFNQGKCKTASGDIENYNDINQVRDCRLVSL
LDLALEKDYVRGKVADYMNKLIDMGVAGFRVDASKHMWPGDLTVIYGSLHNLNTRWFNGG
SRPFIFQEVIDMGGEAIQTSEYFPLGRVTEFKYGAKIGTVFRKWNGEKLSYTKNWGEGWG
FMPDGNALVFIDNHDNQRGHGGGGSAILTFWDARIYKMAVAYMLAHPYGVARVMSSFRWN
RTDDWQGPPSHEDGSTKDVHVNADDTCGDGWVCEHRWRQITNMATFRNVVTGQPHSNWWD
NGSNQVAFGRGNRGFIVFNNDDWQLDVTLNTGMPGGAYCDVISGQRDGGRCTGKTINVGD
DGRAHFKISNTDEDPMVAIHADSKL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatctagttctgttgacactgctggggctgagccaggcttaccacaaccctcat
gctaagcatggcaggcaggccatcgtccacctgtttgagtggaagtggaacgacatcgcg
gctgagtgtgagaggttcctggctcccaaaggatacgctggggttcagatctctcctcct
gctgagagcattttgttgaccagcccgtggagaccatggtgggagcggtaccagccaatc
agctacaacctgtgttccagatcaggaaatgagaacgagctcagagacatgattaccaga
tgcaacaacgttggggttaacatctacgttgatgccgttatcaaccacatgtgtggagct
ggaggtggagagggaacccactctacctgtggaacctatttcaatgccaaaaagatggac
ttcccttccatccccttcagtagctttgatttcaaccaaggcaagtgcaaaactgccagc
ggagacatcgaaaattacaatgatatcaaccaggtgcgtgattgtcgtctggtgagtctg
ctggatcttgccctagagaaggactacgtcagaggaaaggtggccgactacatgaacaag
ctgatcgacatgggagtggctgggttcagagtggatgccagtaaacacatgtggcccggc
gaccttactgtcatctacggaagtctccacaacctcaacacccgctggttcaacggggga
tccagacccttcatattccaggaggttatcgacatgggtggtgaggccatccagacctca
gagtacttccccctaggcagagtcactgagttcaaatatggagccaaaatcggaacagtc
ttccgcaaatggaacggcgaaaagctgtcttacaccaagaactggggtgagggctggggc
ttcatgcccgacggcaatgctcttgtgtttattgataaccatgacaaccagagaggtcat
ggaggaggtggaagcgccatactcaccttctgggacgccaggatttacaagatggccgtg
gcctacatgcttgcccatccctacggggtggcccgtgtgatgtcctccttccgctggaac
cgtactgacgactggcagggccctcccagtcacgaagatggatccaccaaggatgtccac
gtgaacgctgacgacacctgtggagacggatgggtgtgtgagcacaggtggcgccagatt
acgaacatggctaccttccgtaacgtggtgaccggacagccccattctaactggtgggat
aatgggagcaaccaggtggcctttggacgcggcaaccgcggcttcattgtcttcaacaac
gatgactggcagctggatgtgactctgaacactggcatgcccggcggcgcctactgtgat
gtcatttctggccagagggatggagggcgctgcacggggaagaccatcaatgtcggggac
gatggtcgtgcccacttcaagatcagcaacaccgacgaggaccccatggtggcgatccat
gcggactccaagctgtaa

DBGET integrated database retrieval system