KEGG   Salmo salar (Atlantic salmon): 100136517
Entry
100136517         CDS       T04363                                 

Definition
(RefSeq) insulin-like growth factor I
  KO
K05459  insulin-like growth factor 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04068  FoxO signaling pathway
sasa04114  Oocyte meiosis
sasa04115  p53 signaling pathway
sasa04150  mTOR signaling pathway
sasa04510  Focal adhesion
sasa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100136517
   04068 FoxO signaling pathway
    100136517
   04150 mTOR signaling pathway
    100136517
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100136517
   04115 p53 signaling pathway
    100136517
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100136517
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100136517
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    100136517
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   100136517
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 100136517
NCBI-ProteinID: NP_001117095
UniProt: A4GUE7
LinkDB
Position
ssa17
AA seq 176 aa
MSSGHFFQWHVCDVFKSAMCCISCTHTLSLLLCVLTLTSAATGAGPETLCGAELVDTLQF
VCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAARSVRAQ
RHTDMPRTPKVSTAVQNVDRGTERRTAQHPDKTKTKKEVHQKNSSRGNTGGRNYRM
NT seq 531 nt   +upstreamnt  +downstreamnt
atgtctagcggtcatttctttcagtggcatgtatgtgatgtcttcaagagtgcgatgtgc
tgtatctcctgtacccacaccctctcactgctgctgtgcgtcctaaccctgacttcggcg
gcaacaggggcggggcccgagaccctgtgtggggcggagctggtggacacgctgcagttt
gtgtgtggagagagaggcttttatttcagtaaaccaacggggtatggccccagttcacgg
cggtcacataaccgtggtattgtggacgagtgctgcttccagagttgcgagctgcggcgg
ctcgaaatgtactgtgcccctgtcaagtctggcaaggcagctcgctctgtgcgcgcacag
cgccacacagacatgccaagaacacctaaggttagtactgcagtgcaaaacgtggacaga
ggcacagagcgtaggacagcacagcacccagacaagacaaaaaccaagaaggaggtacat
cagaagaactcaagtcgaggaaacacagggggaaggaactaccgaatgtag

KEGG   Salmo salar (Atlantic salmon): 106609475
Entry
106609475         CDS       T04363                                 

Definition
(RefSeq) insulin-like growth factor I
  KO
K05459  insulin-like growth factor 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04068  FoxO signaling pathway
sasa04114  Oocyte meiosis
sasa04115  p53 signaling pathway
sasa04150  mTOR signaling pathway
sasa04510  Focal adhesion
sasa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106609475
   04068 FoxO signaling pathway
    106609475
   04150 mTOR signaling pathway
    106609475
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    106609475
   04115 p53 signaling pathway
    106609475
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106609475
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    106609475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106609475
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   106609475
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 106609475
NCBI-ProteinID: XP_014063817
UniProt: A0A1S3SHJ9
LinkDB
Position
ssa07
AA seq 188 aa
MSSGHFFQWHVCDVFKSAMCCISCTHTLSLLLCVLTLTSAATGAGPETLCGAELVDTLQF
VCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAARSVRAQ
RHTDMPRTPKVSTAVQNVDRGTERRTAQHPDKTKTKKKPLSGHSHTSCKEVHQKNSSRGN
TGGRNYRM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgtctagcggtcatttctttcagtggcatgtatgtgatgtcttcaagagtgcgatgtgc
tgtatctcctgtacccacaccctctcactgctgctgtgcgtcctaaccctgacttcggcg
gcaacaggggcggggcccgagaccctgtgtggggcggagctggtggacacgctgcagttt
gtgtgtggagagagaggcttttatttcagtaaaccaacgggctatggccccagttcacgg
cggtcacataaccgtggtattgtggacgagtgctgcttccagagttgcgagctgcggcgg
ctcgaaatgtactgtgcccctgtcaagtctggcaaggcagctcgctctgtgcgcgcacag
cgccacacagacatgccaagaacacctaaggttagtactgcagtgcaaaacgtggacaga
ggcacagagcgtaggacagcacagcacccagacaagacaaaaaccaagaagaaaccttta
tctgggcatagtcacacatcttgcaaggaggtacatcagaagaactcaagtcgaggaaac
acagggggaaggaactaccgaatgtag

DBGET integrated database retrieval system