Salmo salar (Atlantic salmon): 100136538 Help Entry 100136538         CDS       T04363                                  Symbol S100-A1, S10A1, s100 Name (RefSeq) protein S100-A1   KO K17274   protein S100-A10 Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100136538 (S100-A1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     100136538 (S100-A1)    04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]     100136538 (S100-A1) Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of microglial cells    100136538 (S100-A1) Domain-containing proteins not elsewhere classified [BR:sasa04990]  EF-hand domain-containing proteins   S100 proteins    100136538 (S100-A1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 Astro_p19 DEK_C Motif Other DBs NCBI-GeneID:  100136538 NCBI-ProteinID:  XP_014006874 UniProt:  B5XA95 LinkDB All DBs Position ssa02:complement(7411808..7413714) Genome browser AA seq 101 aa AA seqDB search MPSQLESSMQSLITVFHCYADKDGDCNTLSKKELKELMQTELASFLKSQKDPAAIDKIMK DLDQNGDGKVSFEEFVSLVVGLSIACEQIYQLHTKKVAAKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcagttggagagttccatgcagtccctgatcacggtgttccattgctatgcc gacaaggatggtgactgcaacacactgagcaagaaggagctgaaagaactcatgcagaca gaactggccagcttcctgaagtcccagaaggacccagctgccatagacaagatcatgaag gatctggaccagaatggtgatgggaaggtgagctttgaggagtttgtctctctggtggtg ggcctctccatcgcctgtgaacagatctaccagctccacaccaagaaggttgctgccaag aagtga

DBGET integrated database retrieval system