KEGG   Salmo salar (Atlantic salmon): 100194510
Entry
100194510         CDS       T04363                                 

Gene name
csnk1g2
Definition
(RefSeq) casein kinase 1 gamma 2a
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100194510 (csnk1g2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    100194510 (csnk1g2)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100194510 (csnk1g2)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   100194510 (csnk1g2)
SSDB
Motif
Pfam: Pkinase CK1gamma_C PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 100194510
NCBI-ProteinID: NP_001133068
UniProt: B5DFV5
LinkDB
Position
ssa10
AA seq 414 aa
MDFDKKGSKGETEEGKKMSKAAGSRTGHGGRGTGTNSGVLMVGPNFRVGKKIGCGNFGEL
RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSSEGIPQVYYFGPCGKYNAMVLE
LLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTKSLIYRDVKPENFLVGRPGSKR
QHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGH
MFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFF
EKPDYDYLRKLFTDLFDRNGYVFDYEYDWVGKPLPTPIGPIPSDTPAQPSRDKAQQQTKN
QVMSSTNGELNTDDPTAGHSNAPITAPTEVEVADDTKCCCFFKRRKRKPLQRHK
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggattttgacaagaaggggagtaaaggagagacagaggaagggaaaaagatgtctaag
gcagctggcagcaggactggacatgggggccggggtacagggaccaattctggggttctt
atggttggcccaaacttccgtgtcggaaaaaagattggctgtggcaattttggagagctg
cggctggggaagaacctctacaccaacgaatatgtggccatcaaattggaaccgataaag
tcccgggctccacagcttcacttggaatatagattttataaacagttgggaagttcagag
ggtattcctcaggtgtactactttgggccatgtgggaagtacaatgctatggtgctggag
ctgctggggcccagcctggaagacctgtttgatctctgtgaccgcaccttctccctcaag
accgtcctcatgatagccatacagctgataacgcggatggagtttgtccacacaaagagc
ttgatatacagagacgtgaagccagagaactttttggtggggcggccgggcagcaagagg
cagcacacaatccacatcatcgactttgggctggccaaagaatacatcgaccccgagacc
aaaaaacacatcccgtaccgggagcacaagagcctgacaggcacggcgcgctacatgagc
atcaacacacacctggggaaagagcaaagcagacgggatgatctggaggctctgggtcac
atgtttatgtacttcctgcgaggcagccttccctggcaaggcctgaaggcagacactttg
aaggagaggtatcagaagattggagataccaagcgagctactccaattgaagtgctttgt
gaaagcttcccggaagagatggccacctatctgcgttacgtgaggaggctggacttcttt
gagaaacctgattacgactacttacggaaactcttcactgacctcttcgataggaacggc
tatgtctttgattatgaatacgactgggtcggcaagccacttcctacaccgataggcccc
atccccagtgacacacccgctcagcccagcagagacaaagcacaacagcagaccaaaaac
caggttatgagctcgacaaatggagagctgaacactgacgacccgacggcaggacactcc
aacgctcccattactgctcccacggaggtggaggtggctgatgatacaaagtgctgttgt
ttcttcaaaaggagaaagaggaaacccctccagcggcacaagtga

KEGG   Salmo salar (Atlantic salmon): 100195355
Entry
100195355         CDS       T04363                                 

Gene name
kc1e
Definition
(RefSeq) Casein kinase I isoform epsilon
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100195355 (kc1e)
   04340 Hedgehog signaling pathway
    100195355 (kc1e)
   04068 FoxO signaling pathway
    100195355 (kc1e)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    100195355 (kc1e)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    100195355 (kc1e)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100195355 (kc1e)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   100195355 (kc1e)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100195355 (kc1e)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 100195355
NCBI-ProteinID: NP_001133856
UniProt: B5X3Z8
LinkDB
Position
ssa06
AA seq 415 aa
MDLRVGNKYRLGRKIGSGSFGDIYLGANIATGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRT
AEDGERRGADERDERIVGGPRGSAARGLPPGPNPPAVNRVRNGPEQAISNPAARVQQSGN
TSPRAISRAERERKVSMRLHRGAPANVSSSDLTARLDQSRISTSQVSMPFEHLGK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggatctgagagtggggaacaagtaccgactgggacggaaaatagggagtgggtccttt
ggagacatttaccttggtgccaacattgccacgggcgaggaggtggccattaagctggaa
tgtgtgaagaccaaacacccacagctgcacatcgagagcaagttctacaagatgatgcag
ggaggagtggggattccctcgataaagtggtgcggggcagagggagactacaacgtcatg
gtgatggagctcctgggccccagtctggaagacctcttcaacttctgttcccgcaagttc
agcctcaaaacggtgctactgctggcagaccagatgatcagtcgcatcgagtacatccac
tccaagaacttcatccatcgcgacgtcaagcccgacaacttcctcatggggctggggaag
aagggcaacctggtgtacatcatcgactttggcctggccaagaagtacagagacgcccgc
acacaccagcacatcccctacagggagaacaagaacctgacgggcactgcacgctacgca
tccatcaacacccacctgggcatcgagcagtctcggcgtgacgacctggagtctctggga
tatgtcctcatgtacttcaacctgggctctctgccctggcaaggcctgaaagccgccaca
aagaggcaaaagtacgaacgcatcagcgagaaaaaaatgtccacccccatcgaggtgctc
tgcaaaggatacccctccgagttctccacctacctgaatttctgccgctcgctgcgcttt
gacgacaagccagactactcataccttcggcaactcttcaggaatctgttccacagacaa
ggcttctcctatgactacgtattcgactggaacatgctcaaatttggtgccagtaggaca
gcagaagacggtgagaggaggggagctgacgaaagggacgagcgtatcgtaggaggccct
cggggatctgctgcacgaggtctcccgccagggccaaacccaccagccgtcaacagagtt
aggaatggacctgagcaggccatctctaaccccgccgcacgggtgcagcagtctgggaac
acgtcgccgcgggctatctctcgcgctgagcgtgagcggaaggtgagcatgcggctccac
cgaggagcacccgcaaacgtgtcatcctctgacctcacagcccgtcttgaccaatcccga
atttccacatcgcaggtcagcatgccatttgagcacctggggaagtga

KEGG   Salmo salar (Atlantic salmon): 106561286
Entry
106561286         CDS       T04363                                 

Definition
(RefSeq) casein kinase I isoform gamma-1-like
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106561286
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106561286
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106561286
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   106561286
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 106561286
NCBI-ProteinID: XP_013980542
UniProt: A0A1S3KPH6
LinkDB
Position
ssa10
AA seq 487 aa
MEHPREKEGERPARGSKAGQGRSGHSRPSGSGSSGVLMVGPNFRVGKKIGCGNFGELKLG
KNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKTLGSTAEGLPQVFYFGPCGKYNAMVLELL
GPSLEDLFDLCDRTFSLKTVLMMAIQLLSRIEYVHSKNLIYRDVKPENFLIGRQGHKQEH
IIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMF
MYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCESFPEEMATYLRYVRRLDFFEK
PDYEYLRTLFTELLERKGYTFDYTYDWDGRPIPTPVGAVNVDSGASAITRESNANRDRPS
QQQPLRNQTAASDRRGAWDAQPHRQTNSSYLSSSHLAADRHGGSVQVVSSTNGELNADDP
MTAHSNAPIAAQAEVDVVEEAKYVSAAFYSVVASSLSLPVFVWSSVPFDRTSFFSCNQIK
FYLSHAS
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggagcacccacgggagaaagagggtgagagacctgcacgcggcagcaaggcaggtcag
ggtcgcagcgggcattcgcgcccctcgggatcaggctcctccggagtgctcatggtgggt
cccaacttccgtgtgggcaagaagatcggctgtggtaactttggagagctgaagttaggt
aaaaacctctacaccaatgagtatgttgcaataaaattggaaccaatcaaatcaagggca
ccacagctgcatttggagtaccggttttacaaaacattaggcagcacagcggagggtctt
cctcaggtcttctactttgggccttgtgggaaatacaatgccatggtgttagagctgctg
ggtcccagtctagaagacctctttgacctctgtgacaggaccttctctcttaagaccgtt
ttgatgatggctattcagctgctctcccggattgagtacgtccactccaagaacctcatc
taccgagacgtgaagccagagaacttcctcatcgggcggcaggggcacaagcaggagcac
atcatccacataatcgactttggcctggccaaagagtacatcgaccccgagaccaaaaaa
cacatcccctacagggaacacaagagcctcacagggaccgcccgctacatgtctatcaac
acccacttaggaaaagagcaaagtcgacgggatgacctggaagccctgggccacatgttc
atgtatttcctacgagggagtctgccgtggcaaggactcaaggctgacaccctgaaagag
cgataccagaagattggcgacaccaagcgcaacactcccatcgaggtcctctgtgaaagc
tttccagaagagatggccacctacctgcgctacgtgcggcggttggacttctttgagaag
cccgactacgagtatttgaggactctgttcaccgagctgcttgagcgcaaaggatacacc
tttgactacacctacgactgggatggcagaccgattcctactccggtgggggctgtcaac
gtggactcgggtgcatctgccatcacgagagagagcaacgctaacagagacaggccctct
cagcaacaacccctacggaaccagacggcagcatcagaccgcagaggggcatgggatgca
cagccccaccggcagacaaactcctcctacctgagcagctcccatctggccgcagacagg
catgggggctctgtgcaggtggtcagctccaccaatggggagctgaatgccgatgaccca
atgacggcccactccaacgcacctatcgcagcgcaggccgaagtggatgtggtggaagag
gccaagtacgtttctgccgctttttattctgtcgtagctagctcgctctctctccccgtt
tttgtttggtcatctgtccctttcgatcgcacttcgttttttagttgtaatcaaatcaaa
ttttatttgtcacatgcttcgtaa

KEGG   Salmo salar (Atlantic salmon): 106562785
Entry
106562785         CDS       T04363                                 

Definition
(RefSeq) casein kinase I isoform gamma-1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106562785
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106562785
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106562785
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   106562785
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 106562785
NCBI-ProteinID: XP_013983271
UniProt: A0A1S3KX30
LinkDB
Position
ssa11
AA seq 447 aa
MDHPKEGERPARSSKVAQGRSGHSRPSSSSASSGVLMVGPNFRVGKKIGCGNFGELKLGK
NLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTLGSTAEGLPQVFYFGPCGKYNAMVLELLG
PSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRGGCKKDHI
IHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFM
YFLRGSLPWQGLKADTLKERYQKIGDTKRNTPVEVLCESFPEEMATYLRYVRRLDFFEKP
DYEYLRTLFTELFERKGYTFDYTYDWVGRQIPTPVGTVNMDSGASAITRESHPHRDRPSQ
HQPMRNQTAASDRRGAWEVQPSRTNSSYMASHLASDRHGGSVQVVSSTNGELNADDPLAT
HSNAPITVQAEVEVVDEANCVKMLNLW
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggaccatccaaaagagggtgagcggccggcgaggagcagcaaggtggcacaggggcgc
agcgggcactccagaccctccagctcctcagcctcctccggggttctcatggtgggaccc
aacttccgcgttggcaagaagatcggctgcggcaacttcggagaactgaagcttggtaaa
aacctctataccaacgagtatgtagctattaaactggaaccagtcaagtcgagggcacca
cagttacatttggagtaccggttctacaaaacattaggaagtacagcggaaggcctgccc
caggtgttctactttgggccctgtgggaagtataatgccatggttctagagctgctgggc
cccagtttagaagacctctttgacctttgtgacaggaccttctcactaaagactgtatta
atgattgccattcagctgatctcccggatggagtatgtgcactctaaaaacctcatctac
agagacgtaaagcctgaaaactttctcatcggacgcggaggatgcaaaaaagaccacatt
atccacatcattgactttggcctggccaaagagtacatcgaccctgaaaccaaaaaacac
atcccgtaccgggagcacaagagcttaaccgggacggcccgatacatgtccatcaacaca
catttgggaaaagaacaaagtcgtcgagacgacctggaagccttgggtcacatgttcatg
tacttcctccgtgggagtctaccgtggcaaggactaaaggctgatacactgaaagaacga
taccagaagatcggagacacgaaaagaaacactcccgttgaggttctctgtgagagcttc
ccagaggagatggccacctatttgcgttatgtaagacggttggatttctttgaaaagcct
gactacgaatacctgaggaccctgtttacagagctgtttgaacggaaaggatacaccttt
gattacacctacgactgggtcggcaggcagataccaacaccagtggggactgtcaacatg
gactctggggcatctgccatcacgagagagagccacccgcacagagaccggccctcgcag
caccaacccatgaggaatcagacggcagcttctgaccggaggggagcatgggaagtgcag
cccagtcggacaaactcctcctacatggcctcccacctggcatcggacaggcacgggggc
tcagtgcaggtggtcagttcaacaaatggggagctgaatgccgatgaccctctggcaacc
cactccaacgcaccaatcacagtccaggctgaggtggaggtggtggatgaggccaactgc
gtgaaaatgctcaacctgtggtga

KEGG   Salmo salar (Atlantic salmon): 106569837
Entry
106569837         CDS       T04363                                 

Definition
(RefSeq) casein kinase I isoform gamma-2-like
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106569837
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106569837
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106569837
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   106569837
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 106569837
NCBI-ProteinID: XP_013996959
UniProt: A0A1S3M267
LinkDB
Position
ssa14
AA seq 451 aa
MDFDKRGGGGGKGEAEEGKRMSKSGGSRSGHGSRSSGSGSGVLMVGPNFRVGKKIGCGNF
GELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSSEGVPQVFYFGPCGKYNAM
VLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLVGRPG
SKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEA
LGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRL
DFFEKPDYDYLRKLFTDLFDRNGYVFDYEYDWVGKPLPTPIGPVPSEPLLQSSSRDKAAQ
QTKNQSPEPKGSDSQPTPVTNRELLGSHLTADRLGGSVQVLSSTNGELNTDDPTAGHSNA
PITAPAEVEVADDTKCCCFFKRRKRKGLQRH
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggactttgacaagagaggaggaggaggaggaaagggggaggcagaggaagggaagagg
atgtcgaagtccggagggagccggtcggggcatggtagtcgcagctcggggagcggctcc
ggggtgctcatggtaggccctaacttccgggtcgggaagaagatcggctgtgggaacttt
ggagagctacgcctggggaagaacctgtacactaatgaatatgtggctatcaaactggag
cccatcaagtcccgggccccacagctccacctggagtacaggttctataaacagctgggg
agttcagagggcgtcccccaggtgttctacttcgggccctgtgggaagtataatgccatg
gttctggagctgctgggacccagtctggaagacctgtttgatctgtgtgacagaaccttc
tccctcaagaccgtcctcatgatcgccattcagctgatcacgcggatggagttcgtccac
accaggagtctgatctaccgggatgtgaagccagagaacttcctggttggccggcccggc
agcaagcggcagcacaccatccacatcatagacttcggcctggccaaagagtacatcgac
cccgagaccaagaaacacatcccttacagggagcacaagagcctgacgggcaccgcacgt
tacatgagcatcaatactcacctgggtaaagaacaaagcaggagagacgacctggaagct
ctaggtcacatgttcatgtacttcctgcgaggcagtctaccctggcaaggcctgaaggca
gacactctgaaggagcgttatcagaagataggtgacaccaagagagccacgcccatcgag
gtgctgtgtgagagcttcccagaagagatggccacctacctgcgttatgtgcggcgcctg
gatttctttgagaagccggactacgactacttacggaaactcttcaccgacctcttcgat
aggaacggctacgtctttgattacgagtacgactgggtcggcaagccactgcccactcct
attggtccagtccccagtgagcccctcctacagtccagcagcagagacaaggcagcgcaa
cagaccaaaaaccagtcgccagaacccaaaggaagtgattcccagcccactccagtgacc
aatagggagctgctggggtcccatctaacagctgataggctggggggctctgtccaggtg
ttgagttcaaccaatggggagctgaatacagacgacccgacggcgggccactccaatgca
cccatcaccgccccggccgaggtggaggtggccgacgacaccaagtgctgctgtttcttt
aagaggaggaagaggaaaggcctccagagacactag

KEGG   Salmo salar (Atlantic salmon): 106573333
Entry
106573333         CDS       T04363                                 

Definition
(RefSeq) casein kinase I isoform gamma-1-like
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106573333
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106573333
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106573333
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   106573333
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 106573333
NCBI-ProteinID: XP_014003768
UniProt: A0A1S3MKL6
LinkDB
Position
ssa16
AA seq 465 aa
MEHPREKEGERPARSSKTGQGRSGHSRPSGSSGVLMVGPNFRVGKKIGCGNFGELKLGKN
LYTNEYVAIKLEPIKSRAPQLHLEYRFYKTLGSTAEGLPQVFYFGPCGKYNAMVLELLGP
SLEDLFDLCDRTFSLKTVLMMAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGHKQEHII
HIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMY
FLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCESFPEEMATYLRYVRRLDFFEKPD
YEYLRTLFTELLERKGYTFDYTYDWDGRPIPTPVGSVNVDSGASAITRESHANRDRPSQQ
QPLRNQMAASDRRGAWDAQPHRQTNSSYLSSSHLAADRHGGSVQVVTSTNGDLNADDPMT
AHSNAPITAQAEVEVVEEANCVKLLNLWCCCFFKRKRKKNTPRQK
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggagcacccacgggaaaaagagggtgagcgaccggcgcgcagcagcaagacgggtcag
gggcgcagcgggcactcgcgcccctctggatcctccggagtactcatggttgggcccaac
ttccgtgtgggcaagaagattggctgtggtaactttggagagctgaagctaggtaaaaac
ctctacaccaatgagtatgttgcaataaaattggaaccaataaagtcaagggcaccacag
ctgcatttggagtaccggttttacaaaacattaggcagcacagcggagggtcttcctcag
gtcttctactttgggccgtgtgggaaatacaatgccatggtgttagagctgctgggcccc
agtctagaagacctctttgacctctgtgacaggaccttctctctcaagacagtcttaatg
atggctattcagctgctctcacggatggagtacgtccactccaagaacctcatctaccga
gacgtgaagcccgagaacttcctcatcgggcgtcaggggcacaagcaggagcacatcatc
cacatcatcgactttggcctggctaaagagtacatcgatcccgagaccaaaaaacacatt
ccgtacagggagcacaagagtctcacagggaccgcccgctacatgtctatcaacacccac
ttgggaaaagagcaaagtcgacgggatgacctggaagccctgggccacatgtttatgtat
ttcctacgagggagtctgccgtggcaaggactcaaggctgacaccctgaaggagcgatac
cagaagattggcgacaccaagcgcaacactcccatcgaggtcctctgtgaaagctttcca
gaagagatggccacgtacctgcgctacgtgcggcggttggacttcttcgagaagcccgac
tacgagtatttgaggactctgttcaccgagctgcttgagcgcaaaggttacacttttgac
tacacctacgactgggatggcagaccgattcctactccagtggggtctgtcaacgtggac
tcgggtgcgtctgccatcacgagagagagccacgctaacagagacaggccctctcagcaa
caacccctccggaaccagatggcagcatcagaccgcagaggagcatgggatgcgcagccc
caccggcagacaaattcctcctacctgagcagctcccacctggctgcagacaggcatggg
ggctctgtgcaggtggtaacctccaccaatggggacctgaatgcagacgacccaatgacg
gcccattccaacgcacctatcacagcgcaggccgaggtggaggtggtggaagaggccaac
tgcgtgaaattgctcaacctgtggtgctgttgcttcttcaagcgaaaacggaagaagaac
actccacgacagaaatga

KEGG   Salmo salar (Atlantic salmon): 106584364
Entry
106584364         CDS       T04363                                 

Definition
(RefSeq) casein kinase I isoform gamma-2-like
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106584364
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106584364
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106584364
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   106584364
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 106584364
NCBI-ProteinID: XP_014025063
UniProt: A0A1S3PBN5
LinkDB
Position
ssa23
AA seq 447 aa
MDFDKKVGKGETEEGKNMSKAAGSRTVRGTGTNSGVLMVGPNFRVGKKIGCGNFGELRLG
KNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSSEGIPQVYYFGPCGKYNAMVLELLG
PSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTKSLIYRDVKPENFLVGRPGSKRQHT
IHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFM
YFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFFEKP
DYDYLRKLFTELFDRNGYVFDYEYDWVGKPLPTPVGPFPSDTPAQPSRDKAQQQTKNQLP
EAKGDEAQRQLSPMTNTETLGSHLVAERLGGSVQVMSSTNGELNTDDPTAGHSNAPITAP
TEVEVADDTKCCCFFKMRKRKTLQRHK
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggattttgacaagaaggtgggtaagggagagacggaggaagggaaaaatatgtctaag
gcggctggcagcaggactgtccgaggtacagggaccaactctggggttcttatggttggc
ccaaacttccgcgtcggaaagaaaatcggctgtggcaattttggagagctgcggctgggg
aagaacctctacaccaacgaatatgtggccatcaaattggaaccaataaagtcccgggcg
ccacagcttcatttggaatatagattttataaacagttgggaagttcagagggtattcct
caggtgtactactttgggccatgtgggaagtacaatgccatggtgctggagctgctgggg
cccagcctggaagacctgtttgatctctgtgaccgcaccttctccctcaagaccgtcctc
atgatagccatacagctgataacgcggatggaatttgtccatacaaaaagcttgatatac
agagacgtcaagccggagaactttttggtggggcggccgggcagcaagaggcagcacaca
atccacattatcgacttcgggctggccaaagaatacatcgaccccgagaccaaaaaacac
atcccgtaccgggagcacaagagccttacgggaacggcgcgctacatgagcatcaacaca
cacctggggaaagagcaaagcaggcgggatgacctggaggctctgggtcacatgttcatg
tacttcctgcgaggcagtcttccctggcaaggcctgaaggcggacacgttgaaggagagg
tatcagaagattggagataccaagcgagctaccccaattgaagtgctttgtgaaagcttc
ccggaagagatggccacatatctgcgttacgtgaggaggctggacttctttgagaaacct
gattatgactacttacggaaactcttcactgaactgtttgacaggaacggctacgtcttt
gattatgaatacgactgggtcggcaagccacttcctacaccggtaggtcccttccccagt
gacacgcccgctcagcccagcagagacaaagcacaacagcagaccaaaaaccagttgcct
gaggccaaaggagatgaggctcagcgtcagctgtctccaatgaccaatacggagacactg
gggtcacatcttgtggccgaaaggctggggggctctgtccaggtgatgagctcgacgaat
ggagagctgaacactgacgacccgacggcgggacactccaacgctcccatcactgctccc
accgaggtggaggtggctgatgatacaaagtgctgctgtttcttcaaaatgagaaagagg
aaaactctccagcggcacaagtga

KEGG   Salmo salar (Atlantic salmon): 106589542
Entry
106589542         CDS       T04363                                 

Definition
(RefSeq) casein kinase I isoform epsilon-like
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106589542
   04340 Hedgehog signaling pathway
    106589542
   04068 FoxO signaling pathway
    106589542
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106589542
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106589542
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106589542
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   106589542
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106589542
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 106589542
NCBI-ProteinID: XP_014035126
UniProt: A0A1S3Q560
LinkDB
Position
ssa28
AA seq 421 aa
MELRVGNKYRLGRKIGSGSFGDIYLGINIATGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRT
AEDGERERERERREGKEGDERIGGGPRVPRALPPGGNPPGGVDRIRNGPNAAASNPASRG
VAQSGNRSPQAVSRAERERKVAMRLHRGAPANISSSDLTAQMGQSRIATSQVSVPFEHLG
K
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggaactgagagtggggaacaagtaccgcctcggcaggaagatagggagcggctctttt
ggagacatttacctgggcattaacattgccacgggtgaggaggtggccattaagctggaa
tgtgtgaagaccaaacacccacaactccacatcgagagcaagttctacaagatgatgcag
ggaggagtgggaatcccatccataaagtggtgtggagcagagggagactacaacgtgatg
gtgatggagctgctaggccccagtctggaggacctgttcaacttctgttcccgcaagttc
agcctcaagactgtcctgctgctggctgaccagatgatcagccgtattgagtacatccac
tctaagaacttcatccacagagatgtgaagcctgacaacttcctaatgggcctgggcaag
aagggcaacctggtgtacatcattgactttggcctggccaagaagtaccgcgacgcccgc
acacaccagcacatcccctaccgcgagaacaagaacctgaccggcacggcacgctacgca
tccatcaacacacacctggggatagagcagtctcgtcgtgatgacctggagtctcttggt
tacgtcctgatgtacttcaacctgggctctctgccctggcagggcctcaaggccgccacc
aagaggcagaagtacgaacgcatcagtgagaagaagatgtccacccccatcgaggtgctc
tgcaagggatacccatctgagttctccacctacctgaacttctgtcgctctctgcggttc
gatgacaagccggactactcgtacctgagacagctgttcagaaacttgttccacagacag
ggcttctcctacgactatgtctttgactggaacatgctcaagtttggggccagcaggaca
gccgaggatggggagagggagagggaaagggagaggagagagggaaaagagggggatgag
aggatcggcgggggacctagggtacctcgtgccctacccccgggcggaaaccccccgggc
ggcgtagacaggatcagaaatggccccaatgcagcagcctctaatcctgcttccagagga
gtagcacagtcagggaaccggtccccacaggccgtgtcccgtgcggagcgagagagaaag
gtggccatgaggctccaccgtggcgcccccgccaacatctcctcctctgacctcactgca
cagatgggccaatcacgcatcgccacatcacaggtcagtgtgccatttgaacacctgggg
aagtga

KEGG   Salmo salar (Atlantic salmon): 106589616
Entry
106589616         CDS       T04363                                 

Gene name
csnk1d
Definition
(RefSeq) casein kinase 1 delta
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
sasa04540  Gap junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106589616 (csnk1d)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106589616 (csnk1d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106589616 (csnk1d)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106589616 (csnk1d)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106589616 (csnk1d)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   106589616 (csnk1d)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106589616 (csnk1d)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 106589616
NCBI-ProteinID: XP_014035285
UniProt: A0A1S3Q5N0
LinkDB
Position
ssa28
AA seq 420 aa
MELRVGNRYRLGRKIGSGSFGDIYLGTDISVGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFTAPNS
KGANRAAEEAERERRDREDRLRHGRNPGTRGLPAASGRPRGTQDPAPPTPLTPTSHTANM
SPRPASGMERERKVSMRLHRGAPVNVSSSDLTGHQDTSRMSTSQHSLRQSRQLDARHILV
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggaattaagagtgggaaaccgatacagactgggaaggaaaattggaagtggatccttt
ggagacatctatttaggcacagacatctcagtgggagaggaggtggccatcaagctggaa
tgtgtgaagaccaagcacccacagctccacatcgagagcaagatctacaagatgatgcag
ggaggagtgggcatacctacaataaagtggtgtggagcagagggagactacaacgtgatg
gtgatggagctgctaggccccagtctggaggacctgttcaacttctgttcccgcaagttc
agcctcaagactgtcctgctgctggctgaccagatgatcagccgtattgagtacatccac
tctaagaacttcatccacagagatgtgaagcctgacaacttcctgatgggcctgggcaag
aagggcaacctggtgtacatcattgactttggcctggccaagaagtaccgcgacgcccgc
acacaccagcacatcccctaccgcgagaacaagaacctgaccggcacggcacgctatgca
tctatcaacacacacctggggatagagcagtctcgtcgtgatgacctggagtctcttggt
tacgtcctgatgtacttcaacctgggctctctgccctggcagggcctcaaggccgccacc
aagaggcagaagtacgaacgcatcagcgagaagaagatgtccacccctatcgaggtgctc
tgcaagggatacccctcggagttctccacctacctgaacttctgtcgctctctgcggttc
gatgacaagccggactactcgtacctgagacagctgttcagaaacctgttccacagacag
ggcttctcctacgactatgtctttgactggaacatgctcaagtttactgcccctaattcc
aagggggccaaccgtgcagcggaggaggcggagcgggagcggagggacagagaggatagg
ctgagacacggcaggaaccctgggaccaggggactcccggccgcctcaggacgaccccga
ggaacacaggatccggcgccgcctacacccctcacacccacctcacacacagccaacatg
tctccacgaccggcgtctggtatggaacgggagagaaaagtgagcatgcggcttcaccgc
ggagctcccgttaacgtctcctcgtccgacctgacgggacaccaggacacctctcgcatg
tccacctcacagcattcccttcgacaatcacgccaactagatgctcgccatatccttgtg
tga

KEGG   Salmo salar (Atlantic salmon): 106595407
Entry
106595407         CDS       T04363                                 

Definition
(RefSeq) casein kinase I isoform delta-B-like
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
sasa04540  Gap junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106595407
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106595407
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106595407
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106595407
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106595407
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   106595407
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106595407
SSDB
Motif
Pfam: Pkinase Pkinase_fungal PK_Tyr_Ser-Thr APH Kdo
Other DBs
NCBI-GeneID: 106595407
NCBI-ProteinID: XP_014042253
UniProt: A0A1S3QQB4
LinkDB
Position
Un
AA seq 248 aa
LSPLQISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPY
RENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYER
ISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYV
FDWNMLKFGANRAAEDAERERRAGEDRLRQGQARAPAGARGIPSASGRPRGAQDAAAPAP
LTPTSHTG
NT seq 747 nt   +upstreamnt  +downstreamnt
ctctctcctctccagatcagccgtatagagtacatccactctaagaacttcatccacaga
gacgtgaagccagacaacttcctgatgggcctgggcaagaagggtaacctggtgtacatc
atcgactttggactggccaagaagtaccgtgacgcccgcacacaccagcacatcccctac
cgcgagaacaagaatctgaccggcacagcacgctacgcatccatcaacacacacctggga
atcgagcagtctcgtcgtgatgacctggagtctcttggctatgtcctgatgtacttcaac
ctgggcagtctgccctggcagggcctgaaggctgccactaagagacagaagtacgaacgc
atcagtgagaagaagatgtctacccccatcgaggtcctctgtaaaggatacccatcggag
tttgccacgtacctgaacttctgccgttctctgcggttcgatgacaagccagactactct
tacctcagacagctgttcaggaacctgttccacagacagggcttctcctacgactacgtc
ttcgactggaacatgctcaagtttggcgccaacagggcagcggaggatgcagagagggag
aggagagccggtgaggacagactgagacagggacaggccagggcccctgcaggggccaga
gggattccctccgcctccggacgacccagaggagcacaggacgcagccgcacccgcaccc
cttacacccacctcacacacaggttag

KEGG   Salmo salar (Atlantic salmon): 106596082
Entry
106596082         CDS       T04363                                 

Definition
(RefSeq) casein kinase I isoform delta-like
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
sasa04540  Gap junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106596082
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106596082
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106596082
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106596082
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106596082
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   106596082
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106596082
SSDB
Motif
Pfam: Pkinase Pkinase_fungal PK_Tyr_Ser-Thr APH Kdo Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 106596082
NCBI-ProteinID: XP_014042872
UniProt: A0A1S3QT57
LinkDB
Position
Un
AA seq 303 aa
LIELSPLQISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQH
IPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQK
YERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSY
DYVFDWNMLKFGANRAAEDAERERRAGEDRLRQGQARAPAGARGIPSASGRPRGAQDAAA
PAPLTPTSHTGMERERKVSMRLHRGAPVNISSSDLTGRQDSRMSTSQALSRVTPSGLQSA
APR
NT seq 912 nt   +upstreamnt  +downstreamnt
ttgatcgagctctctcctctccagatcagccgtatagagtacatccactctaagaacttc
atccacagagacgtgaagccagacaacttcctgatgggcctgggcaagaagggtaacctg
gtgtacatcattgactttggcctggccaagaagtaccgtgacgcccgcacacaccagcac
atcccctaccgcgagaacaagaatctgaccggcacagcacgctacgcatccatcaacaca
cacctgggaatcgagcagtctcgtcgtgatgacctggagtctcttggctatgtcctgatg
tacttcaacctgggcagtctgccctggcagggcctgaaggctgccactaagagacagaag
tacgaacgcatcagtgagaagaagatgtctacccccatcgaggtcctctgtaaaggatac
ccatctgagtttgccacgtacctgaacttctgccgttctctgcggttcgatgacaagcca
gactactcttacctcagacagctgttcaggaacctgttccacagacagggcttctcctac
gactacgtcttcgactggaacatgctcaagtttggcgccaacagggcagcggaggatgca
gagagggagaggagagccggtgaggacagactgagacagggacaggccagggcccctgca
ggggccagagggatcccctccgcctccggacgacccagaggagcacaggacgcagccgca
cccgcaccccttacacccacctcacacacaggtatggagcgagagaggaaggtcagcatg
cgtcttcaccgtggagctcctgtcaacatctcctcctcagacctgactggacgacaggac
tcacgcatgtccacctcacaggctctctctcgtgtcacccccagtggcctccagtcagca
gcccctcgatga

KEGG   Salmo salar (Atlantic salmon): 106596267
Entry
106596267         CDS       T04363                                 

Definition
(RefSeq) casein kinase I isoform gamma-3-like
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106596267
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106596267
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106596267
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   106596267
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 106596267
NCBI-ProteinID: XP_014043052
UniProt: A0A1S3QTQ9
LinkDB
Position
ssa03
AA seq 447 aa
MDFDKRGGGGGGKGEAEEGKRMSKSGGSRSRSSGSSSGVLMVGPNFRVGKKIGCGNFGEL
RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSSEGVPQVFYFGPCGKYNAMVLE
LLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLVGRPGSKR
QHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGH
MFMYFLRGSLPWQGLKADTLKERYQKIGDTKRTTPIEVLCESFPEMATYLRYVGSLDFLE
KPDYDYLRKLFTDLFDSNGYIFDYEYDWVGKPLPTPIGPVPSETLLQSSSRDKATQQTKN
QSPEPKGSDSQPTPVTNRELLGSHLTADRLGGSVQVMSSTNGELNTDDPTAGHSNAPITA
PAEVEVADDTKCCCFFKRRTGQGLQRH
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggactttgacaagagaggaggaggaggaggaggaaagggggaggcagaggaagggaag
aggatgtcaaagtccggagggagccgtagtcgcagctcggggagcagctccggggtgctc
atggtgggccctaacttccgggtcgggaagaagatcggctgtgggaactttggagagcta
cgcctggggaagaacctgtacactaatgaatatgtggccatcaaactggagcccatcaag
tcccgggccccacagctccacctggagtacaggttctataaacagctggggagttcagag
ggcgtcccccaggtgttctacttcgggccctgtgggaagtataatgccatggttctggag
ctgctgggacccagtctggaagacctgtttgatctgtgtgacagaaccttctccctcaag
accgtcctcatgatcgccattcagctgatcacgcggatggaattcgtccacaccaggagt
ctaatctaccgggacgtgaagccagagaacttcctggttggccggcccggcagcaagcgg
cagcacaccatccacatcatcgacttcggcctggccaaagagtacatcgaccccgagacc
aaaaaacacatcccgtaccgggagcacaagagccttacgggaacggcgcgctacatgagc
atcaacacacacctggggaaagagcaaagcaggcgggatgacctggaggctctgggtcac
atgttcatgtacttccttcgaggcagtctgccctggcaaggcctgaaggcagacactctg
aaggagcgctatcagaagataggtgacaccaagagaaccacgcccatcgaggtgctgtgt
gagagcttcccagagatggccacttacctgcgttatgtgggttctctggacttcttggag
aagccggactacgactacttacggaaactcttcaccgacctcttcgatagcaacggctac
atctttgactatgagtacgactgggtcggcaagccactgcctactcccattggtccagtc
cccagtgagacccttctacagtccagcagcagagacaaggcaacgcagcagaccaaaaac
cagtcgccagaacccaaaggaagtgattcccagcccactccagtgaccaatagggagctg
ctggggtcccatctaacagctgataggctggggggctccgtccaggtgatgagttcgacc
aatggggagctgaatacagacgatccgactgcgggccactccaacgcccccatcaccgcc
ccggccgaggtggaggtggccgacgacacaaagtgctgctgtttctttaagaggaggacg
gggcaaggcctccagagacactag

KEGG   Salmo salar (Atlantic salmon): 106601228
Entry
106601228         CDS       T04363                                 

Definition
(RefSeq) casein kinase I isoform epsilon
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106601228
   04340 Hedgehog signaling pathway
    106601228
   04068 FoxO signaling pathway
    106601228
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106601228
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106601228
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106601228
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   106601228
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106601228
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 106601228
NCBI-ProteinID: XP_014048741
UniProt: A0A1S3R9E0
LinkDB
Position
ssa03
AA seq 415 aa
MDLRVGNKYRLGRKIGSGSFGDIYLGANIATGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGHPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRT
AEDGERRGADERDERIVGGPRGSAARGLPPGPNPPAANRVRNGPEQAISNPASRVQQSGN
TSPRAISRAERERKVSMRLHRGAPANVSSSDLTARLDQSRISTSQVSMPFEHLGK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggatctgagagtggggaataagtaccgactgggacggaaaatagggagtggttccttt
ggagacatttaccttggtgccaacattgccacgggtgaggaggtggccattaagttggaa
tgtgtgaagactaaacacccacagctgcacatcgagagcaagttctataagatgatgcag
ggaggagtggggattccctcgataaagtggtgcggggcagagggagactacaacgtcatg
gtgatggagctcctgggccccagtctggaagacctcttcaacttctgttcccgcaagttc
agcctcaaaacggtgctactgctggcagaccagatgatcagtcgcatcgagtacatccac
tccaagaacttcatccatcgcgatgtcaagcccgacaacttcctcatggggctggggaag
aagggcaacctggtgtacatcatcgactttggcctggccaagaagtacagagacgcccgc
acacaccagcacatcccctacagggagaacaagaacctgacgggcactgcacgctacgca
tccatcaacacccacctgggcatcgagcagtctcggcgtgatgacctggaatctctggga
tatgtcctcatgtacttcaacctgggctctctgccctggcaaggcctcaaagccgccaca
aagaggcagaagtacgaacgcatcagtgagaaaaaaatgtctacccccatcgaggtgctc
tgcaaaggacacccctccgagttctccacctacctgaatttctgccgctcgctgcgcttt
gacgacaagccagactactcataccttcgtcagctcttcaggaatctgttccacagacaa
ggcttctcctatgactacgtattcgactggaacatgctcaaatttggtgccagtaggaca
gcagaagacggtgagaggaggggagctgacgaaagggacgagcgtatcgtaggaggccct
cggggatccgctgcacggggtctcccgccagggccaaacccaccagccgccaacagagtt
aggaatggaccagagcaggccatctctaaccccgcctcacgggtgcagcagtctgggaac
acgtcgccgcgggctatctctcgcgctgagcgtgagcggaaggtgagcatgcggctccac
cgaggagcacccgcaaacgtgtcatcctctgacctcacagcccgtcttgaccaatcccga
atttccacatcgcaggtcagcatgccatttgagcacctggggaagtga

KEGG   Salmo salar (Atlantic salmon): 106604944
Entry
106604944         CDS       T04363                                 

Definition
(RefSeq) casein kinase I isoform alpha
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106604944
   04340 Hedgehog signaling pathway
    106604944
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106604944
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106604944
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   106604944
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin ABC1
Other DBs
NCBI-GeneID: 106604944
NCBI-ProteinID: XP_014055569
UniProt: A0A1S3RV09
LinkDB
Position
ssa05
AA seq 378 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSLAVSSSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSGGQGQQAQTPTGKQTDKPKS
NMKVAPLPLVEGIPGAQG
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggcaagcagcagcggctctaaagccgaatttattgtcggtgggaaatacaagcttgtc
agaaaaattggatctgggtcatttggtgacatatacctcgcgatcaacatcacaaatgga
gaggaggtagctgtaaaattggaatctcagaaagccagacacccacagttgttatatgaa
agcaaactgtacaaaatcttacaaggaggagttggaatcccacacataaggtggtatggc
caagaaaaggactacaatgtcctagtgatggacctgctgggacccagtctggaagacctc
ttcaacttctgctcgcgccggttcaccatgaaaactgtactaatgctcgcagaccaaatg
atcagcagaatcgagtatgtgcacacaaagaacttcattcacagagatatcaagccagac
aactttttaatgggtattggccgtcactgtaacaagtgtttagaatctccagtggggaag
aggaaaagaagcttggctgttagttcttctcaggacccatctttctcaggattaaaccag
ttgttcctcattgactttggtctggccaaaaaataccgggacaaccggacacgacagcac
ataccctacagagaagacaaaaatctcacaggcacagctcgctatgccagcatcaacgca
catctgggaatcgagcagagtcgccgagatgacatggagtcgctaggatacgtcctgatg
tatttcaacagaaccagcctgccctggcagggactaaaggctgccacaaagaaacagaag
tacgagaagattagcgagaagaagatgtcgactccggtcgaggtgttgtgtaagggtttt
cccgcagagtttgccatgtacctgaactactgccgtgggctgcggtttgaggaggcgcct
gactacatgtacctgcgtcagctgttccgcattctcttcaggaccctgaaccaccagtac
gactacacgtttgactggacaatgctgaagcagaaagcagcacagcaggccgcgtcctca
gggggacaggggcaacaggcacaaacccctacaggcaagcaaactgacaaacccaagagt
aacatgaaagtcgcccccctccctctcgtagagggtatcccgggtgcccagggttga

KEGG   Salmo salar (Atlantic salmon): 106609470
Entry
106609470         CDS       T04363                                 

Definition
(RefSeq) casein kinase I isoform epsilon-like
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106609470
   04340 Hedgehog signaling pathway
    106609470
   04068 FoxO signaling pathway
    106609470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106609470
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106609470
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106609470
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   106609470
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106609470
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 106609470
NCBI-ProteinID: XP_014063815
UniProt: A0A1S3SHK1
LinkDB
Position
ssa01
AA seq 414 aa
MELRVGNKYRLGRKIGSGSFGDIYLGVNIATGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRT
AEDGERERREADERIGGGPRAPRALPLGSNPPGGVDRIRNGPNAAASNPASRGVPQSGNR
SPQAVSRAERERKVAMRLHRGAPANISSSDLTAQMGQSRIATSQVSVPFEHLGK
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggagctgagagtgggaaacaagtaccgccttggcaggaagatagggagcggctctttt
ggagacatttacctgggcgttaacatcgccacgggtgaggaggtggccattaagctggaa
tgtgtgaagaccaaacacccacaactccacatcgagagcaagttctacaaaatgatgcag
ggaggagtgggcatcccgtccataaagtggtgtggagcagagggagactacaacgtgatg
gtgatggagctgctaggccccagtctggaggacctgttcaacttctgttcccgcaagttc
agcctcaagactgtcctgctgctggctgaccagatgatcagccggattgagtacatccac
tctaagaacttcatccacagagatgtgaagcctgacaacttcctgatgggcctgggtaag
aagggcaacctggtgtacattatcgactttggcctggccaagaagtaccgcgacgcccgc
acacaccagcacatcccctaccgcgagaacaaaaacctgaccggcaccgcgcgctacgca
tccatcaacacacatctggggatagaacagtctcgtcgtgatgatctggagtctcttggt
tatgtcctgatgtacttcaacctgggctctctgccctggcagggcctcaaggccgccacc
aagaggcagaagtacgaacgcatcagcgagaagaagatgtccacccctattgaggtgctc
tgtaagggatacccctctgagttctccacctacctgaacttctgtcgctctctgcggttc
gatgacaagccagactactcatacttgagacaactgttcagaaacttgttccacagacag
ggcttctcctacgactacgtctttgactggaacatgctcaagtttggggccagcaggaca
gccgaggatggggagcgggagaggagagaggcggatgagaggatcggagggggacctagg
gcaccccgtgccctacccctgggcagtaaccccccggggggcgtagacaggatccgaaat
ggccccaatgcagcagcttctaaccctgcctccagaggagtcccacagtcagggaaccgg
tccccgcaggctgtgtcccgtgcggagagagagaggaaggtggccatgaggctccaccgc
ggtgcccccgccaacatctcctcctctgacctcactgcacagatgggccaatcacgcatc
gccacatcacaggtcagtgtgccatttgaacacctggggaagtga

KEGG   Salmo salar (Atlantic salmon): 106610228
Entry
106610228         CDS       T04363                                 

Definition
(RefSeq) casein kinase I isoform delta-B
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
sasa04540  Gap junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106610228
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106610228
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106610228
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106610228
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106610228
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   106610228
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106610228
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo Rrn6
Other DBs
NCBI-GeneID: 106610228
NCBI-ProteinID: XP_014064922
UniProt: A0A1S3SKR0
LinkDB
Position
ssa01
AA seq 420 aa
MELRVGNRYRLGRKIGSGSFGDIYLGTDISVGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFTAPNS
KGANRAAEEAERERRDREDRLRHSRNPGARGLPAASGRPRGTQDTAPPTPLTPTSHTANT
SPRPVSGMERERKVSMRLHRGAPVNVSSSDLTGHQDTSRMSTSQMVPGMIPGGLHSAAPR
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggaattgagagtgggaaaccgatacaggctgggcaggaaaattggaagtggatctttt
ggagacatctacttgggcacagacatctcagtgggagaggaggtggccattaaactggaa
tgtgtgaagaccaaacacccccagctccacatagagagtaagatctacaagatgatgcag
ggaggagtgggcatcccgtccataaagtggtgtggagcagagggagactacaacgtgatg
gtgatggagctgctaggccccagtctggaggacctgttcaacttctgctcccgcaagttc
agcctcaagactgtcctgctgctggctgaccagatgatcagccggattgagtacatccac
tctaagaacttcatccacagagatgtgaagcctgacaacttcctgatgggcctgggtaag
aagggcaacttggtgtacatcatcgactttggcctggccaagaagtaccgcgacgcccgc
acacaccagcacatcccctaccgcgagaacaaaaacctgaccggcaccgcgcgctacgca
tccatcaacacacacctgggaattgagcagtctcggcgtgatgacctggagtctctgggt
tatgtcctgatgtacttcaacctgggctctctgccctggcagggcctcaaggccgccacc
aagagacagaagtacgaacgcatcagcgagaagaagatgtccacccccatcgaggtgctc
tgcaagggatacccctctgagttctccacctacctgaacttctgtcgttctctgcggttc
gacgacaagccagactactcgtacctcagacagctgttcaggaacctgttccatagacag
ggcttctcttacgactacgtctttgactggaacatgctcaagtttactgcccctaattcc
aagggggccaaccgagcagcagaggaggcggagcgggagcggcgggacagagaggatagg
ctgagacacagcaggaaccccggggccaggggactccctgccgcctcaggacgacccaga
ggaacacaggacaccgcgccgcctacacccctcacacccacctcacacacagccaacaca
tctccacgaccggtgtccggtatggagcgggagaggaaagtgagcatgcggcttcaccgg
ggagctcccgttaacgtctcctcgtccgacctgacgggacaccaggacacctcccgcatg
tctacctcacagatggtgcctggtatgatccctggtggcctccactctgcagcgcctcga
tga

KEGG   Salmo salar (Atlantic salmon): 106611977
Entry
106611977         CDS       T04363                                 

Definition
(RefSeq) casein kinase I isoform alpha-like
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106611977
   04340 Hedgehog signaling pathway
    106611977
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106611977
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106611977
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   106611977
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin ABC1
Other DBs
NCBI-GeneID: 106611977
NCBI-ProteinID: XP_014068181
UniProt: A0A1S3SV11
LinkDB
Position
ssa09
AA seq 368 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSLAVSSSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKVGQAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFE
EAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSGGQGQPAQTPSGKQTDK
PKSNMKGF
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggcaagcagcagcggctcaaaagccgaattcattgtcgggggaaaatacaaacttgtc
agaaaaattggatctggatcatttggtgacatatacctggcgatcaacatcacaaatgga
gaggaggtagctgtaaaattggaatctcagaaagccagacacccacagttgttatatgaa
agcaagctgtacaaaatattacaaggaggagttggaatcccacacataaggtggtatggc
caagaaaaggactacaatgtcctagtgatggacctgctgggacctagtctggaagacctc
ttcaacttctgctcgcgcaggttcacaatgaaaactgtactaatgctcgcagaccagatg
atcagcagaatcgagtatgtgcacacaaagaacttcattcacagagatatcaagccagac
aactttttaatgggtattggccgtcactgtaacaagtgtttggaatctccagtggggaag
aggaaaagaagcttggctgttagttcttctcaggacccatctttctcaggattaaaccag
ttgttcctcatcgactttggtctggccaaaaaataccgggacaacaggacacgacagcac
ataccctaccgagaagacaagaatctcaccggcacagcacgctatgccagcatcaacgcg
cacctgggcatcgagcagagtcgccgagatgacatggagtcgctaggctacgtcctgatg
tacttcaacagaaccagcctgccctggcagggtctaaaggtaggccaggctgccacaaag
aaacagaagtacgagaagattagcgagaagaagatgtccactccagtcgaggtgttgtgt
aagggtttcccagcagagttcgccatgtacctgaactactgccgtgggctgcgattcgag
gaggcgcctgactacatgtacctgcgtcagctgttccgcattctcttcaggactttgaac
caccagtacgactacacgtttgactggacgatgctgaagcagaaagcagcccagcaggct
gcgtcctcagggggacaggggcaaccggcacaaactccctcaggcaagcaaactgacaaa
cccaagagtaacatgaaaggtttctga

DBGET integrated database retrieval system