KEGG   Salmo salar (Atlantic salmon): 100194530Help
Entry
100194530         CDS       T04363                                 

Gene name
sdha
Definition
(RefSeq) succinate dehydrogenase complex, subunit A, flavoprotein (Fp)
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00020  Citrate cycle (TCA cycle)
sasa00190  Oxidative phosphorylation
sasa01100  Metabolic pathways
sasa01200  Carbon metabolism
Module
sasa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sasa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sasa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100194530 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100194530 (sdha)
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100194530 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 100194530
NCBI-ProteinID: NP_001133088
UniProt: B5DFZ8
LinkDB All DBs
Position
ssa27
AA seq 661 aa AA seqDB search
MAAVCTVSRVLTKKLLSAKALPAVSHNSRKLHFSVYGKNNSKVSDGMSTQYPVVDHEFDA
VVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEGDDWRWHFY
DTVKGSDWLGDQDAIHYMTEQAPHAVVELENFGMPFSRTEDGKIYQRAFGGQSLKYGKGG
QAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECKGVIALCMEDGSI
HRFRSKNTVIATGGYGRTYFSCTSAHTSTGDGNAMVTRAGLPCQDLEFVQFHPTGIYGAG
CLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSITIEIREGRGCGPEKDHA
YLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYRGQVITH
THEEGDKVVPGLFACGEAACASVHGANRLGANSLLDLVVFGRACAHTIADICTPGEKLSP
LKPNAGEESVANLDKLRFADGNIRTSEIRVNMQKTMQNHAAVFRTGKVLKEGCDKMDAVY
QTLDDIKTFDRGIVWNTDLVETLELQNLMLNAVQTINSAEQRQESRGAHSREDFKDRMDE
LDYAKPLAGQVKKPIEEHWRKHTLSTVDPKTGKVTLKYRPVIDNSLDAEDCAAIPPAIRS
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggtgtgtactgtctcccgtgtcctcaccaaaaagctgctgtcagccaaggcg
cttccggctgtatcccacaactccaggaagctccacttctcagtctatgggaagaacaac
tctaaagtatcagatggcatgtccacacagtacccagtggtagaccatgagtttgatgca
gtggttgtgggtgccggtggagcagggctgcgtgctgctttcggtctgtctgaggctggc
ttcaacacagcttgtgtcacaaagctgttccccaccaggtcacacacggtggctgcacag
ggtgggatcaacgcagcccttggaaacatggagggagatgattggaggtggcacttctac
gacacggtgaagggatctgattggctgggagaccaggacgccattcactacatgacagag
caggctccacatgctgtggtggagctggagaactttggcatgcccttcagccgtaccgag
gatggtaaaatctaccagagggcttttggaggccagagtctgaagtatggcaagggaggc
caggcccacaggtgttgctgcgtagctgacagaaccggccactccctcctgcacacactc
tacggacgatctctgaggtacgacaccagctactttgtggagtactttgccctggacctg
ctgatggaggatggagagtgcaagggagtaattgctctgtgtatggaggacggatcgatc
caccgcttcagatccaagaacacggtcatcgccacaggtggttatggccgtacctacttc
agctgcacctcagcccacaccagcacgggagacggtaatgccatggtgacccgtgctggc
cttccctgccaagacctggagtttgtccagttccaccctacaggcatctatggagctggc
tgtctgatcacagagggttgccgtggtgagggaggaatcctcatcaacagtgagggtgag
cgcttcatggagcgttatgctcctaacgccaaggacctggcctccagagacgtggtgtcc
cgctccattaccatcgagattcgagagggcaggggatgtggcccagagaaggaccatgca
tacctgcagctgcaccatctccctccacagcagctggccactcgtctacctggcatctct
gagaccgccatgatcttcgccggtgtggacgtcaccaaagagcccatccccgtcctgccc
actgtacactacaacatgggaggaatccccaccaactacaggggacaggtcatcacccac
acgcacgaggagggtgacaaggtggtgccagggctgtttgcctgtggcgaggctgcctgt
gccagtgtccatggtgccaaccgtctgggagccaactccctgttggatctggtggtgttt
ggtcgcgcctgcgctcacacaattgctgacatctgcactccaggagagaagctctccccc
ctgaagcccaacgcaggagaggagtctgtggccaacctggacaagctgaggtttgctgat
ggcaacataaggacctctgagatcagagtgaacatgcagaagaccatgcagaaccacgcc
gctgtgttccgtaccggcaaggtcctgaaggagggatgtgacaagatggacgccgtctac
caaaccctggacgacatcaagacctttgacagaggcattgtgtggaacactgacctggtg
gagaccctggagctgcagaaccttatgctgaacgctgtgcagaccatcaactctgccgag
cagcgccaggagagcaggggagcccactccagagaggacttcaaggaccgtatggatgag
cttgactacgccaagcctctggcgggacaggtgaagaagcccattgaagagcactggaga
aaacacaccctgtccactgtggatcctaagaccgggaaggtaactctgaaatacagaccg
gttattgataactcactggatgcagaggactgtgctgctatccctcccgccatccgttcc
tattaa

DBGET integrated database retrieval system