KEGG   Salmo salar (Atlantic salmon): 100194605
Entry
100194605         CDS       T04363                                 

Gene name
akt2
Definition
(RefSeq) v-akt murine thymoma viral oncogene homolog 2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100194605 (akt2)
   04012 ErbB signaling pathway
    100194605 (akt2)
   04370 VEGF signaling pathway
    100194605 (akt2)
   04371 Apelin signaling pathway
    100194605 (akt2)
   04068 FoxO signaling pathway
    100194605 (akt2)
   04150 mTOR signaling pathway
    100194605 (akt2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100194605 (akt2)
  09143 Cell growth and death
   04210 Apoptosis
    100194605 (akt2)
   04218 Cellular senescence
    100194605 (akt2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100194605 (akt2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100194605 (akt2)
   04625 C-type lectin receptor signaling pathway
    100194605 (akt2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100194605 (akt2)
   04920 Adipocytokine signaling pathway
    100194605 (akt2)
   04914 Progesterone-mediated oocyte maturation
    100194605 (akt2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100194605 (akt2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100194605 (akt2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100194605 (akt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    100194605 (akt2)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100194605 (akt2)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100194605 (akt2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11
Other DBs
NCBI-GeneID: 100194605
NCBI-ProteinID: NP_001133162
UniProt: B5DGG0
LinkDB
Position
ssa11
AA seq 479 aa
MNEASVVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPELSDQSLPPLNNFSVGEC
QLMKTERPKPNTFVIRCLQWTTVIERTFHVESNAEREGWMRAIQAVANGLKVREEEEPMD
LFGSPSDSSSIEEMEVAMSKTNSKVTMSDFDYLKLLGKGTFGKVILVKEKATGMHYAMKI
LRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFFHLS
RDRVFTEDRARFYGAEIVSALEYLHSRDVVYRDLKLENLMLDNDGHVKITDFGLCKEGIT
DGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELI
LMEEIRFPKNLAPEGRALLTGLLKKDPKQRLGGGPDDAKEVMSHKFFTSINWQDVVDRKL
TPPFKPQVTSETDTRYFDDEFTAQTITVTPPDKYTNLDCGIPNQPAHFPQFSYSASIRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaatgaggccagcgtagtcagggaaggatggctccacaagagaggtgagtacatcaag
acttggaggccgcgctacttcatcctgaagagtgacggctccttcattggctacaaagag
aagcctgagctgtccgaccagagcttgccccctctcaacaatttctcagtgggagaatgc
cagctgatgaaaacagagcggcccaagccaaacacgttcgttatccgctgcctgcagtgg
accactgtcatcgagaggaccttccacgtagaaagcaatgcagagagagaggggtggatg
cgtgccatccaggcggtggccaatgggttgaaggtacgagaggaggaggagcccatggac
ctgtttggttctcccagtgacagcagcagcattgaggagatggaggtggccatgtccaag
accaactccaaggtgacgatgagtgactttgactacctgaagctgctggggaaggggacg
tttggcaaagtgatcctggtcaaggagaaagccacggggatgcactatgccatgaagatc
ctgcgcaaggaggtcatcatcgctaaggacgaggtagcgcacacggttacagagagcaga
gtgttacagaacacccggcatcccttcctaacaacactgaaatacgctttccagactcat
gatcgattatgttttgtgatggaatacgccaatggaggagagctcttcttccacctgtct
cgggatcgtgtgttcacggaagaccgggcccgtttctatggcgctgagatcgtatctgcg
ttggagtacctccactctcgtgacgtggtatacagggacctgaagctggagaatctaatg
ctggacaatgacggacatgttaaaatcacagactttgggctgtgtaaggagggcatcacg
gacggtgccaccatgaagaccttctgcggcaccccggagtacctggcgccggaggtgctg
gaggacaacgactacggccgggcggtggactggtggggcctgggcgtggtcatgtacgag
atgatgtgcggtcggctgcccttctacaaccaggaccacgagcggctttttgagctcatc
ctcatggaggagatccgattccccaagaacctggccccagagggcagggccctgctcacc
ggcctgctcaaaaaggatcccaagcaaaggttagggggaggaccggatgatgccaaagaa
gtgatgtcccacaagttcttcacctctatcaactggcaggacgtggtcgatagaaagctg
actccacccttcaagcctcaggtgacgtcagagactgatacacgttacttcgacgacgag
ttcacggcacagaccatcaccgtcacgcctccagacaagtataccaacctggactgtggc
atccccaaccagccagcacacttcccccagttctcttactctgccagcatacgagagtga

KEGG   Salmo salar (Atlantic salmon): 106564869
Entry
106564869         CDS       T04363                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106564869
   04012 ErbB signaling pathway
    106564869
   04370 VEGF signaling pathway
    106564869
   04371 Apelin signaling pathway
    106564869
   04068 FoxO signaling pathway
    106564869
   04150 mTOR signaling pathway
    106564869
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106564869
  09143 Cell growth and death
   04210 Apoptosis
    106564869
   04218 Cellular senescence
    106564869
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106564869
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106564869
   04625 C-type lectin receptor signaling pathway
    106564869
  09152 Endocrine system
   04910 Insulin signaling pathway
    106564869
   04920 Adipocytokine signaling pathway
    106564869
   04914 Progesterone-mediated oocyte maturation
    106564869
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106564869
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106564869
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106564869
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106564869
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106564869
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   106564869
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C APH
Other DBs
NCBI-GeneID: 106564869
NCBI-ProteinID: XP_013986822
UniProt: A0A1S3L778
LinkDB
Position
ssa12
AA seq 480 aa
MSDQNVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKDKPQDADLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDERDEWAEAIQMVADSLAKQEEEGSLCS
PTSQIENEVNEEEMDTSTSQHKRKTMNDFDYLKLLGKGTFGKVILVKEKASGTYYAMKIL
KKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSR
ERVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHVKITDFGLCKEGITD
AATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELIL
MEEIKFPRTLSSDSKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFVAVDWQDVYDKKLV
PPFMPQVSSETDTRYFDEEFTAQTITITPPEKYDEDGMGEGDSERRPHFPQFSYSASGRE
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagcgaccaaaacgttgtcaaggaaggctgggttcagaagagaggtgagtacataaag
aactggaggccgcgttacttcctgctgaagaccgacggatccttcatcggctacaaagac
aaaccccaggacgcagacctggcctatcccctcaataacttctctgtagcaaaatgtcag
ctgatgaagacggagcggcccaagcccaacacattcatcatccgctgtttgcagtggacc
acggttattgagaggacattccacgtggacacgcccgatgagagggatgagtgggccgag
gccatccaaatggtggctgactccctggccaagcaggaggaggagggcagcctgtgcagc
cccacgtcgcagatcgagaacgaggtcaacgaggaggagatggacacctccaccagccaa
cacaaacggaagacaatgaatgactttgactatctgaaactactgggcaaaggcactttt
gggaaagtcattctggtgaaggagaaggcaagcggaacgtattacgccatgaagatcctg
aagaaggaagtcatcatcgccaaggacgaagttgctcacaccctcacagaaagcagagtg
ttaaaaaacacccggcatccattcctaacctctctgaagtactcctttcagaccaaggac
cggttgtgcttcgtcatggagtatgtaaacggaggagagctgtttttccatttgtcaaga
gagcgagtgttctctgaggaccgcacgcgattctacggagctgagatcgtctccgcttta
gactaccttcactctgccaagatagtgtaccgcgatctgaagctggagaacttgatgctg
gataaagacgggcacgtcaagatcacggacttcggcctctgcaaagagggaatcacagac
gcggccaccatgaagaccttctgcggcacgccggagtacctggctccagaggtgctggag
gacaatgattacggccgggcggtggactggtggggtctgggcgtggtcatgtacgagatg
atgtgcggccggctgcccttctacaaccaggaccacgagaagctgtttgagctgatcctc
atggaggagatcaagtttccgcgcacgctctcctccgactccaagtctctgctctccggc
ctgctcatcaaggaccccaacaaacgacttggtggcggtccagacgacgcaaaggagatc
atgcgccacagtttctttgtggcggtagactggcaagacgtctacgacaaaaagttggtc
ccccccttcatgccccaggtgtcctcagagacggacacccggtatttcgatgaggagttc
acggcacagacgatcaccatcactcccccggaaaaatacgatgaagacgggatgggtgag
ggtgacagcgaacggaggcctcatttcccacaattctcgtattcggccagcggacgggag
tga

KEGG   Salmo salar (Atlantic salmon): 106571474
Entry
106571474         CDS       T04363                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106571474
   04012 ErbB signaling pathway
    106571474
   04370 VEGF signaling pathway
    106571474
   04371 Apelin signaling pathway
    106571474
   04068 FoxO signaling pathway
    106571474
   04150 mTOR signaling pathway
    106571474
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106571474
  09143 Cell growth and death
   04210 Apoptosis
    106571474
   04218 Cellular senescence
    106571474
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106571474
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106571474
   04625 C-type lectin receptor signaling pathway
    106571474
  09152 Endocrine system
   04910 Insulin signaling pathway
    106571474
   04920 Adipocytokine signaling pathway
    106571474
   04914 Progesterone-mediated oocyte maturation
    106571474
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106571474
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106571474
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106571474
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106571474
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106571474
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   106571474
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C Seadorna_VP7 FTA2 Pkinase_fungal
Other DBs
NCBI-GeneID: 106571474
NCBI-ProteinID: XP_014000099
UniProt: A0A1S3MAN8
LinkDB
Position
ssa15
AA seq 474 aa
MGEVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDIDQLETPLNNFSVAPE
CQLMKTERPKPNTFIIRCLQWTTVIERTFHVDSPEEREQWTKAIQEVADGLQKQEEERMD
SSPDPMDMEMYLTKPKLKVTMPDFEYLKLLGKGTFGKVILVKEKATGKYYAMKILKKEVI
VAKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTPDRLCFVMEYANGGELFFHLSRDRVFS
EERARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATM
KTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEI
RFPRTLGPEGKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIEWQDVYEKKLVPPFK
PQVTSETDTRYFDVEFTGQTITITPPGQDDSMESFDSDRRPHFPQFSYSASGTA
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgggcgaagtagtcattgtgaaggagggatggcttcacaaacgaggagagtacataaag
acttggagacccaggtatttcttgctgaagagcgacggtacgttcatcgggtacaaggag
cgaccgcaagacatcgaccaactggagacgccactcaataacttctcagtagcaccagaa
tgtcagctgatgaaaacagagcgtcctaagcccaacacattcatcatccgctgcctgcaa
tggaccactgtcatagagcgcaccttccacgtggacagcccagaggagagggagcagtgg
acgaaggccatccaggaggtggcagatgggctgcagaaacaggaggaggagaggatggac
tcctcgccagaccccatggacatggagatgtacctcaccaaacccaaacttaaagtgact
atgcccgactttgaatacctcaagctcttgggaaaaggcacttttgggaaggttatcctg
gtgaaggaaaaagccacaggaaaatactacgctatgaaaatcctcaagaaagaagtgatt
gtggcgaaagatgaagtagcgcacactctcactgaaaacagagtactgcagaactccaaa
caccccttcttaacgggtctgaagtactccttccagacgcctgaccgcttgtgtttcgtc
atggagtatgccaatggaggagagctgttctttcacctatcacgagaccgtgtgttctcc
gaggagagggcccggttctacggagctgagattgtgtcggcgctggactacctccactcg
gagaagaacgtggtttacagggacctgaagctggaaaacctgatgctggacaaagacggc
cacatcaagatcacagactttggcctgtgtaaggagggcatcaaggacggggccaccatg
aagaccttctgtgggacgccagagtacctggcccccgaggtgctggaggacaatgactac
ggtcgtgctgtggactggtggggtctgggtgtggtcatgtatgagatgatgtgcggtcga
ctgcccttctacaaccaggaccacgagaagctgtttgagctgatcctgatggaggagatc
cgcttccctaggaccctggggcccgagggaaagtccctgctctctggtctgctcaagaag
gaccccaagcagaggttaggtggagggcctgatgacgccaaggagataatgcagcacaag
ttcttcgctgggatcgagtggcaagacgtgtatgagaagaagctggtcccacccttcaag
ccccaggtcacctcggaaacagacacccgctattttgatgtggagttcaccgggcagacc
atcaccatcacacctccaggacaagatgacagcatggagtctttcgacagcgacaggaga
ccccacttcccccagttctcctactctgccagtggaacagcctga

KEGG   Salmo salar (Atlantic salmon): 106581334
Entry
106581334         CDS       T04363                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106581334
   04012 ErbB signaling pathway
    106581334
   04370 VEGF signaling pathway
    106581334
   04371 Apelin signaling pathway
    106581334
   04068 FoxO signaling pathway
    106581334
   04150 mTOR signaling pathway
    106581334
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106581334
  09143 Cell growth and death
   04210 Apoptosis
    106581334
   04218 Cellular senescence
    106581334
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106581334
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106581334
   04625 C-type lectin receptor signaling pathway
    106581334
  09152 Endocrine system
   04910 Insulin signaling pathway
    106581334
   04920 Adipocytokine signaling pathway
    106581334
   04914 Progesterone-mediated oocyte maturation
    106581334
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106581334
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106581334
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106581334
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106581334
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106581334
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   106581334
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11
Other DBs
NCBI-GeneID: 106581334
NCBI-ProteinID: XP_014018803
UniProt: A0A1S3NTQ3
LinkDB
Position
ssa20
AA seq 481 aa
MNDISVVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPEMSSDHSLPPLNNFSVAE
CQLMKTERPRPNTFVIRCLQWTTVIERTFHVESNEEREEWMRAIQAVANGLKTREEEAPM
DITFGSPSDCSSMEEMEVAMSKSRNKVTMSDFDYLKLLGKGTFGKVILVKEKATGMYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFFH
LSRDRVFTEDRARFYGAEIVSALEYLHSRDVVYRDLKLENLMLDKDGHIKITDFGLCKEG
ITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPKNLAPEAKALLAGLLKKDPKQRLGGGQEDAKDVMTHMFFTTINWQDVVER
KLLPPFKPQVTSETDTRYFDDEFTAQTITVTPPDKYHSLDAEDQDQRTHFPQFSYSASIR
D
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgacatcagtgtggtcagagagggctggctccataagaggggagagtacattaag
acgtggaggccgcggtacttcatcctgaagagtgatggctccttcatcggctacaaggag
aaaccagagatgtcgtccgaccacagcctcccacccctcaacaacttctctgtggcagag
tgccagctgatgaagacagaacggcccaggcccaacacgtttgtcatacgctgcctacag
tggaccacagtcatagagcgcaccttccacgtggagagtaacgaggaaagggaggaatgg
atgcgggcgatccaagcggtggccaacggcctgaagacgcgagaggaagaggcgcccatg
gacatcacgtttggctcccccagcgactgcagcagcatggaggagatggaggtggccatg
tccaagtcccgcaataaagtgaccatgagtgactttgactacctgaagctgctggggaag
ggaacgtttggtaaagtgattctggtgaaggagaaggccacaggaatgtactacgccatg
aagatcctgaggaaagaagtcatcatcgctaaggatgaggtagcacacacggtaacagaa
agcagagtccttcagaatacaaggcatcccttcttaacgacactgaaatacgcgttccaa
acacatgaccggctatgctttgtgatggaatatgcaaatggaggagagctgttctttcac
ttgtcgcgagaccgtgtgttcacagaagaccgggcacggttctacggtgcagagattgtg
tctgcgctggagtacctccactcacgggacgttgtctacagagaccttaagctggagaac
ttaatgctggataaagatggacacataaagatcacagattttggactgtgtaaagaggga
atcacagatggggctaccatgaagaccttttgtggtactccagaataccttgcgccagag
gtattagaggacaatgactacggccgagcggtggactggtggggtctgggtgtggtcatg
tacgagatgatgtgcggtcgactacccttctacaaccaggaccacgagcggttgtttgag
ctcattctcatggaggagatccgcttccccaagaacctggcccccgaagccaaggccctg
cttgctggcctgctcaaaaaggaccccaagcagaggcttggaggtggacaagaagatgcc
aaggacgtgatgactcatatgttcttcaccaccatcaactggcaggatgtggtagagagg
aagctcttgcctcccttcaagccccaggtgacgtcggagacggatacgcggtactttgac
gatgagttcacggcacagaccatcaccgtaacgcccccggacaagtaccacagcttagac
gcagaagaccaggaccagcgcacacacttccctcagttctcttactccgccagcatacgg
gactga

KEGG   Salmo salar (Atlantic salmon): 106582637
Entry
106582637         CDS       T04363                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106582637
   04012 ErbB signaling pathway
    106582637
   04370 VEGF signaling pathway
    106582637
   04371 Apelin signaling pathway
    106582637
   04068 FoxO signaling pathway
    106582637
   04150 mTOR signaling pathway
    106582637
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106582637
  09143 Cell growth and death
   04210 Apoptosis
    106582637
   04218 Cellular senescence
    106582637
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106582637
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106582637
   04625 C-type lectin receptor signaling pathway
    106582637
  09152 Endocrine system
   04910 Insulin signaling pathway
    106582637
   04920 Adipocytokine signaling pathway
    106582637
   04914 Progesterone-mediated oocyte maturation
    106582637
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106582637
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106582637
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106582637
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106582637
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106582637
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   106582637
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7
Other DBs
NCBI-GeneID: 106582637
NCBI-ProteinID: XP_014021395
UniProt: A0A1S3P1I2
LinkDB
Position
ssa01
AA seq 473 aa
MTHVAIMKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDAFETPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQAVADGLQKQEEEMMDS
SPDPMDMEMYLTKPRLKVTMDDFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFSE
ERSRFYGAEIVSALDYLHAERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGITDGATMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIR
FPRTLGQEGRSLLSGLLKKDPKQRLGGGQDDAKEIMQHKFFAGIEWQDVYEKRLVPPFKP
QVTSETDTRYFDEEFTAQTITITPPGQEDSMESFDSERRPHFPQFSYSASGTA
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgacccatgtggcgataatgaaggagggatggctgcacaaaagaggagagtacattaag
acctggaggcccaggtattttctactcaagagtgatggtacattcattggctacaaggaa
cgaccacaagatgttgacgcgtttgaaacccccttaaataacttctcagtagcacagtgc
cagctgatgaagacggagaggcccaagcccaacacattcatcatccgctgcctgcagtgg
accactgtcatcgagcgcaccttccacgtggagacccccgaggagagggaagaatggacg
aaagccattcaggctgtagcagatggcctacagaaacaggaagaggagatgatggactcc
tccccagacccaatggacatggagatgtacctgaccaaacccagactcaaagtgactatg
gacgactttgaatacctcaaactcctcggaaaaggtacttttggcaaagtgatcctggtg
aaggagaaggccacaggacgctactatgccatgaaaatcctgaagaaggaagtgatcgta
gcgaaagatgaagtggcacacacactcacagaaaaccgagtgctccagaattccaagcat
ccattcttgacgggcctgaaatactccttccagacccacgaccggttgtgtttcgtgatg
gagtatgcgaacggcggagagctgttcttccacctctcccgggaccgggtgttctcggag
gagcggtctcggttctacggggcggagatagtgtcagcgctggactacctgcatgctgag
aggaacgtggtctacagagacctgaagctggaaaatctcatgctggacaaagacggacac
ataaagatcaccgactttggactgtgtaaggaggggatcacagacggggccaccatgaag
accttctgtgggacaccagagtacctggccccagaggtgctggaggacaatgattacggt
cgggcggtggactggtggggtctgggcgtggtcatgtacgagatgatgtgtggtcggctg
cccttctacaaccaggaccacgagaagctgtttgagctcatcctcatggaggacatccgt
ttcccacgtaccctgggtcaggagggcaggtccctgctctccggcctgctcaaaaaggac
cccaagcagcggttaggtggaggacaggatgatgctaaggagattatgcagcacaaattc
tttgctgggattgaatggcaagatgtttatgagaaaaggctggtcccgcccttcaagccc
caggttacctcggaaacagatacacggtattttgacgaggagttcacagcacagaccatc
actattacaccacccggacaagaagacagcatggagtcgtttgacagcgaacggagaccc
cacttcccacagttttcctactctgcgagtggaacagcctaa

KEGG   Salmo salar (Atlantic salmon): 106585772
Entry
106585772         CDS       T04363                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106585772
   04012 ErbB signaling pathway
    106585772
   04370 VEGF signaling pathway
    106585772
   04371 Apelin signaling pathway
    106585772
   04068 FoxO signaling pathway
    106585772
   04150 mTOR signaling pathway
    106585772
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106585772
  09143 Cell growth and death
   04210 Apoptosis
    106585772
   04218 Cellular senescence
    106585772
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106585772
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106585772
   04625 C-type lectin receptor signaling pathway
    106585772
  09152 Endocrine system
   04910 Insulin signaling pathway
    106585772
   04920 Adipocytokine signaling pathway
    106585772
   04914 Progesterone-mediated oocyte maturation
    106585772
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106585772
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106585772
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106585772
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106585772
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106585772
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   106585772
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C APH
Other DBs
NCBI-GeneID: 106585772
NCBI-ProteinID: XP_014027845
UniProt: A0A1S3PJL0
LinkDB
Position
ssa02
AA seq 480 aa
MSDQNVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKDKPQDADLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDERDEWAEAIQMVADSLAKQEEEGILCS
PTSQIENEVNEEEMDTSTSQHKRKTMNDFDYLKLLGKGTFGKVILVKEKASGTYYAMKIL
KKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSR
ERVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHVKITDFGLCKEGITD
TATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELIL
MEEIKFPRTLSSDSKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFVAVDWQDVYDKKLV
PPFMPQVSSETDTRYFDEEFTAQTITITPPEKYDEDGMGEGDSERRPHFPQFSYSASGRE
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagcgaccaaaacgttgtcaaggaaggctgggttcagaagagaggtgagtacataaag
aactggaggccgcgctacttcctgctgaagacagacggatccttcatcggctacaaagac
aaaccccaggacgcggacctggcctatcccctcaataacttctctgtagcaaaatgtcag
ctgatgaagacggagcggccgaagcccaacacgttcatcatccgctgtttgcagtggaca
acggttattgagaggacattccacgtggacacgcccgatgagagggatgagtgggccgag
gccatccagatggtggccgactccctggccaagcaggaggaggaggggatcctgtgcagc
cccacgtcgcagatcgagaacgaggtcaacgaggaggagatggacacctccaccagccaa
cacaaacggaagacaatgaatgactttgactatctgaaactactgggcaaaggcactttt
gggaaagtcattctggtgaaggagaaagcgagtggaacttattatgccatgaagatcctg
aagaaagaagtcatcatcgccaaggacgaagttgctcacaccctcacagaaagcagagtg
ttgaaaaacacccggcatccattcctaacctctctaaagtactcctttcagaccaaggac
cggttgtgcttcgtcatggagtatgtgaacggaggagagctgtttttccatttgtcaaga
gagcgagtgttttccgaggaccgcacgcggttctacggagctgagatcgtctccgcttta
gactaccttcactctgccaagatagtgtaccgcgatctgaagctggagaacttgatgctg
gataaagacgggcacgtcaagatcacagacttcggcctctgcaaagagggcatcaccgac
acggccaccatgaagaccttctgcggcacgccagagtacctggctccagaggtgctggag
gacaatgactacggccgggcggtggactggtggggtctgggcgtggtcatgtatgagatg
atgtgcggccggctgcccttctacaaccaggaccacgagaagctgtttgagctgatcctc
atggaggagatcaagtttccacgcacgctctcctccgactccaagtccctgctctctggc
ctgctcatcaaggaccccaacaaacgactcggtggcggtccagacgatgcgaaggagata
atgcgccacagtttctttgtggctgtagactggcaagacgtctacgacaaaaagttggtc
ccccccttcatgccacaagtctcgtcagagacagacacccggtatttcgatgaggagttc
acggcacagacgatcaccatcactcccccggaaaaatacgatgaagatgggatgggcgag
ggtgacagcgaacggaggcctcatttcccacaattctcgtattcggccagtggacgagag
tga

KEGG   Salmo salar (Atlantic salmon): 106589689
Entry
106589689         CDS       T04363                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106589689
   04012 ErbB signaling pathway
    106589689
   04370 VEGF signaling pathway
    106589689
   04371 Apelin signaling pathway
    106589689
   04068 FoxO signaling pathway
    106589689
   04150 mTOR signaling pathway
    106589689
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106589689
  09143 Cell growth and death
   04210 Apoptosis
    106589689
   04218 Cellular senescence
    106589689
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106589689
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106589689
   04625 C-type lectin receptor signaling pathway
    106589689
  09152 Endocrine system
   04910 Insulin signaling pathway
    106589689
   04920 Adipocytokine signaling pathway
    106589689
   04914 Progesterone-mediated oocyte maturation
    106589689
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106589689
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106589689
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106589689
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106589689
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106589689
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   106589689
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C FTA2 APH
Other DBs
NCBI-GeneID: 106589689
NCBI-ProteinID: XP_014035429
UniProt: A0A1S3Q7R0
LinkDB
Position
ssa28
AA seq 480 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEERDEWTEAIQIVADKLQRQEEERIQCS
PTSQMDNIGELEEMDTSTSHHKRKTMNDFDYLKLLGKGTFGKVILVREKANGKYYAMKIL
KKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSR
ERVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHVKITDFGLCKEGITD
AATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELIL
MEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMGHSFFTGIEWQDVYDKKLI
PPFKPQVSSETDTRYFDEEFTAQTITITPPEKFDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagcgatgtcaccatcgtcaaagaaggctgggtgcaaaaaaggggagaatatatcaag
aactggagaccacgctacttcctgctgaaaacggacggatcgttcataggttacaaagag
aagccacaggacgcagacctaccctatccccttaataacttctctgttgcaaaatgccaa
ctgatgaagacagaacgaccaaagcccaacacattcatcatcagatgtctacaatggacc
accgtcatagagaggaccttccatgtggacacaccagaggaaagggatgagtggacggag
gcgatccagatagtagcagacaaactccaaagacaggaggaagagaggatccaatgcagt
cccacgtctcagatggacaacatcggagagctggaggagatggacacctctaccagccac
cataaacggaagacaatgaatgactttgactacttaaaactactgggaaaaggcactttt
ggtaaagtgattctagtgagagagaaggctaacgggaaatattatgcaatgaagattttg
aagaaagaagtcattattgcaaaggatgaagtggcacacacactcacagagagcagagta
ttaaaaaacacaaggcaccctttcctaacttctttgaagtattccttccagactaaagac
cgcctgtgctttgtaatggaatatgtgaatggaggagagctgtttttccatttgtcgaga
gagcgggtgttctctgaggaccgcacgcgcttctacggtgccgaaatagtctccgctctg
gactacctgcactccgccaagattgtgtaccgggatctcaagctggagaacctaatgcta
gacaaagacggacacgtcaaaatcacagacttcgggctctgcaaggaaggaatcacagat
gctgctacaatgaagactttctgtggaacgccggagtacctagctccagaggtgctggag
gacaacgactacggccgggcggtggactggtggggtctgggcgtggtcatgtacgagatg
atgtgtggtcggctgcccttctacaaccaggaccacgagaagctgtttgagctcatcctc
atggaggacatcaagttcccccgcacgctgtcgtcagacgccaagtcactgctgtcagga
ctactcataaaggaccccaacaaaaggcttggaggaggtccagatgatgctaaagaaatc
atgggacatagtttctttactggaatcgagtggcaagatgtttatgataagaagctgata
ccgcccttcaaacctcaggtgtcgtcagagacagataccaggtattttgacgaagaattc
acggcacagacaattacaataactccccctgaaaaatttgatgaagatgggatggattgc
atggacaacgagcggagaccacacttcccccagttctcctactcggccagtgggagagaa
tga

KEGG   Salmo salar (Atlantic salmon): 106602915
Entry
106602915         CDS       T04363                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106602915
   04012 ErbB signaling pathway
    106602915
   04370 VEGF signaling pathway
    106602915
   04371 Apelin signaling pathway
    106602915
   04068 FoxO signaling pathway
    106602915
   04150 mTOR signaling pathway
    106602915
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106602915
  09143 Cell growth and death
   04210 Apoptosis
    106602915
   04218 Cellular senescence
    106602915
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106602915
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106602915
   04625 C-type lectin receptor signaling pathway
    106602915
  09152 Endocrine system
   04910 Insulin signaling pathway
    106602915
   04920 Adipocytokine signaling pathway
    106602915
   04914 Progesterone-mediated oocyte maturation
    106602915
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106602915
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106602915
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106602915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106602915
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106602915
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   106602915
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11
Other DBs
NCBI-GeneID: 106602915
NCBI-ProteinID: XP_014051384
UniProt: A0A1S3RHY7
LinkDB
Position
ssa04
AA seq 479 aa
MNEVSVVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPELSVQSLPPLNNFSVGEC
QLMKTERPKPNTFVIRCLQWTTVIERTFHVESNAEREEWMRAIQAVANGLKVREEEEPMD
LFGSPSDNSSMEEMEVAMSKTRSKVTMSDFDYLKLLGKGTFGKVILVKEKATGMYYAMKI
LRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFFHLS
RDRVFTEDRARFYGAEIVSALEYLHSRDVVYRDLKLENLMLDNDGHIKITDFGLCKEGIT
DGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELI
LMEEIRFPRNLAPEGKALLAGLLKKDPKQRLGGGPDDAKDVMSHKFFTSINWQDVVDRKL
TPPFKPQVTSETDTRYFDDEFTAQTITVTPPDKYDNLDCEDPNQPAHFPQFSYSASIRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaatgaggtcagcgtagtccgagaaggatggctccacaagagaggtgagtacattaag
acttggaggccgcgctacttcatcctaaagagtgatggctccttcatcggctacaaagag
aagcctgagctgtccgtccagagcttgcccccgctcaacaacttctcagtgggagaatgc
cagctgatgaagacagagcggcccaagcctaacacattcgttatccgctgcctgcagtgg
acaacagtcatcgagaggaccttccatgtagaaagcaatgcagagagagaggagtggatg
cgtgccatccaggcggtggccaatgggttgaaggtgcgagaggaggaagagcccatggac
ctgtttggctctcccagcgacaacagcagcatggaggagatggaggtggccatgtccaag
acccgctccaaagtgacgatgagcgactttgactacctgaagctgctggggaagggcaca
tttggcaaggttatcctggtgaaggagaaagccacggggatgtactacgccatgaagatc
ctgcgcaaggaggtcatcatcgctaaggatgaggttgcgcacacggttacagagagcaga
gtgttacagaacacccggcatcccttcctcacaacactgaaatacgctttccagactcat
gaccgattatgttttgtgatggaatatgccaacggaggagagctcttcttccacctgtct
cgggatcgcgtgttcacggaagaccgggcccgtttctatggcgctgagattgtatctgcg
ttggagtacctccattctcgtgatgtggtatacagggacctgaagctggagaatctaatg
ctggacaatgacggacatattaaaatcaccgacttcgggctatgtaaggaaggtatcaca
gacggtgccaccatgaagaccttctgtggcaccccagagtaccttgcaccggaggtgctg
gaggacaatgactacggtcgcgctgtggattggtggggcctgggcgtggtcatgtacgag
atgatgtgcggtcggctgcccttctacaaccaggaccacgagcggctgtttgagctcatc
ctcatggaggagatccgcttcccccggaacctggcccccgaggggaaggcgctgctcgca
ggcctgctcaaaaaggaccccaagcagaggttagggggaggaccagatgatgccaaagat
gtgatgtctcacaagttcttcacctccatcaactggcaggatgtggtagataggaagctg
actccgcccttcaagcctcaggtgacgtcagagaccgacacccgctactttgacgatgag
ttcacggcacagaccatcacagtcacacctccagacaagtatgacaatctggactgtgag
gaccccaaccagccagcacacttcccccagttctcttactccgccagcatacgagagtga

KEGG   Salmo salar (Atlantic salmon): 106607890
Entry
106607890         CDS       T04363                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106607890
   04012 ErbB signaling pathway
    106607890
   04370 VEGF signaling pathway
    106607890
   04371 Apelin signaling pathway
    106607890
   04068 FoxO signaling pathway
    106607890
   04150 mTOR signaling pathway
    106607890
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106607890
  09143 Cell growth and death
   04210 Apoptosis
    106607890
   04218 Cellular senescence
    106607890
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106607890
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106607890
   04625 C-type lectin receptor signaling pathway
    106607890
  09152 Endocrine system
   04910 Insulin signaling pathway
    106607890
   04920 Adipocytokine signaling pathway
    106607890
   04914 Progesterone-mediated oocyte maturation
    106607890
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106607890
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106607890
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106607890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106607890
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106607890
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   106607890
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C FTA2 Pkinase_fungal PH_11
Other DBs
NCBI-GeneID: 106607890
NCBI-ProteinID: XP_014060837
UniProt: A0A1S3S922
LinkDB
Position
ssa06
AA seq 474 aa
MGEVVIVKEGWLHKRGEYIKTWRPRYFLLKRDGTFIGYKERPQDVDQLETPLNNFSVAPE
CQLMKTERPKPNTFIIRCLQWTTVIERTFHVESPEDREQWTKAIQEVADGLQKQEEERMD
SSPDPMDMEMYLTKPKLKVTMHDFEYLKLLGKGTFGKVILVKEKATGKYYAMKILKKEVI
VAKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFS
EERARFYGAEIVSALDYLHLEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATM
KTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEI
RFPRTLGPEGKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIEWQDVYEKKLVPPFK
PQVTSETDTRYFDVEFTGQTITITPPGQDDSMESFDSDRRPHFPQFSYSASGTA
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgggtgaagtagtcattgtgaaggagggatggcttcacaaacgaggagagtacataaag
acctggaggcccaggtatttcttgctgaagagagacggtacgttcatcgggtacaaggag
cgaccgcaagacgtcgaccaactggagacgccactcaataacttctcagtagcaccagaa
tgtcagctgatgaagactgagcgacccaagcccaacacattcatcatccgctgcctacag
tggaccactgtcatagaacgcaccttccatgtggagagcccagaggatagggagcagtgg
acaaaggccatccaggaggtggctgatgggctgcagaaacaggaggaggagaggatggac
tcctcaccagaccccatggacatggagatgtacctcaccaagcccaaactcaaagtgact
atgcacgactttgaatacctcaaactcttgggaaaaggcacttttgggaaggttatcctg
gtgaaggaaaaagcaaccggaaaatactacgctatgaaaatcctcaagaaagaagtgatt
gtggcaaaagatgaagtagcacacactctcactgaaaaccgagtactgcagaactccaaa
caccccttcttaacgggtctgaagtactccttccagacgcacgaccgcttgtgtttcgtc
atggagtacgccaatggaggggagctgttcttccacctatcacgagaccgtgtgttctcc
gaggagagggcccggttctacggagcggagatcgtgtcggcactggactacctccacttg
gagaaaaatgtggtttacagggacctgaagctggaaaacctgatgctggacaaagacggc
cacataaagatcacagactttggcctgtgtaaggagggcatcaaggacggggccaccatg
aaaaccttctgtgggacaccagagtatctggcccctgaggtgctggaggacaatgactac
ggtcgtgctgtggactggtggggtctgggtgtggtcatgtatgagatgatgtgcggtcga
ctgcccttctacaaccaggaccacgagaagctgtttgagctgatcctgatggaggagatc
cgctttcctagaaccctgggccccgagggaaagtccctgctctctggcctgctcaagaag
gaccccaagcagaggttaggtggagggcctgatgacgccaaggagataatgcagcacaag
ttcttcgctgggatcgagtggcaagatgtgtacgagaagaagctggtcccgccattcaag
ccccaggtcacctcggaaacggacacccgctattttgacgtggagttcaccgggcagacc
atcacaatcacacctccaggacaagatgacagcatggagtctttcgacagcgacaggaga
ccccacttccctcagttctcctactctgccagtgggacagcctga

KEGG   Salmo salar (Atlantic salmon): 106610858
Entry
106610858         CDS       T04363                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106610858
   04012 ErbB signaling pathway
    106610858
   04370 VEGF signaling pathway
    106610858
   04371 Apelin signaling pathway
    106610858
   04068 FoxO signaling pathway
    106610858
   04150 mTOR signaling pathway
    106610858
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106610858
  09143 Cell growth and death
   04210 Apoptosis
    106610858
   04218 Cellular senescence
    106610858
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106610858
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106610858
   04625 C-type lectin receptor signaling pathway
    106610858
  09152 Endocrine system
   04910 Insulin signaling pathway
    106610858
   04920 Adipocytokine signaling pathway
    106610858
   04914 Progesterone-mediated oocyte maturation
    106610858
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106610858
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106610858
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106610858
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106610858
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106610858
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   106610858
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 APH FTA2
Other DBs
NCBI-GeneID: 106610858
NCBI-ProteinID: XP_014065969
UniProt: A0A1S3SNP6
LinkDB
Position
ssa09
AA seq 473 aa
MTDVAIVKEGWLHKRGEYIKTWRPRYFLLKTDGTFIGYKERPQHVEALETPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIEAVADGLQKEEEEMMDS
SPDPMDMEMYLTKPRLKVTMHDFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFSE
ERARFYGAEIVSALDYLHAERNVVYRDLKLENLMLDKDGHIQITDFGLCKEGITDGATMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIR
FPRTLGPEGRSLLSGLLKKDPKQRLGGGQNDAKEIMQHKFFAGIEWQDVYEKKLVPPFKP
QVTSETDTRYFDEEFTAQTITITPPGQEDSMELFDSERRPHFPQFSYSASGTA
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgactgatgtggcgatagtgaaggagggatggctgcacaaaagaggagagtacattaag
acctggaggcctaggtattttctactcaagactgatggtacattcattggctacaaggaa
cggccacaacatgttgaggcacttgaaacccctttaaataacttctcagtagcacagtgc
cagctgatgaagacagagaggcccaagcccaacacattcatcatccgctgcctgcagtgg
accactgttatcgagcgcaccttccacgtggagactcccgaggagagggaagaatggacg
aaggccattgaggccgtagcagacggtctacagaaagaggaggaggagatgatggactcc
tccccagacccaatggacatggagatgtacctgaccaaacccagactcaaagtgactatg
cacgactttgaatacctcaaactcctaggaaaaggcacttttggcaaagtgatcctggtg
aaggagaaggccacaggacgctactatgccatgaaaatcctgaagaaggaagtaatcgta
gcgaaagatgaagtggcacacacactcacagaaaaccgagtgctacagaattccaagcat
ccgttcttgacgggcctgaaatactccttccagactcatgaccggttgtgtttcgtcatg
gagtatgcgaacggcggagagctgttctttcacctgtcccgggaccgggtgttctcggag
gagcgggctcggttctacggggcggagatagtgtcagcactggactacctgcatgctgag
aggaacgtggtctacagagatctgaagctggaaaatctcatgctggacaaagacggacac
atacaaatcactgactttggactgtgcaaggaggggatcacagacggggccaccatgaag
accttctgtgggacgccagagtacctggccccagaggttctggaggacaatgactacggc
cgggcggtggactggtggggtctgggcgtggtcatgtacgagatgatgtgtggtcggctg
cccttctacaaccaggaccacgagaagctgtttgagctcatcctcatggaggacatccgt
ttcccacgcaccctgggccccgagggcaggtccctgctctcaggcctgctcaagaaggac
cccaagcagcggttaggtggtggacagaatgatgctaaagagatcatgcagcacaaattc
tttgctgggattgaatggcaagatgtttatgagaagaagctggtcccgccctttaagccg
caggttacctcagaaacagacacgcggtattttgacgaggagttcacagcacagaccatc
actattacaccgcccggacaagaagacagcatggagttgtttgacagcgaacggaggccc
cacttcccacagttctcctactctgcgagtgggacagcctaa

KEGG   Salmo salar (Atlantic salmon): 106613111
Entry
106613111         CDS       T04363                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106613111
   04012 ErbB signaling pathway
    106613111
   04370 VEGF signaling pathway
    106613111
   04371 Apelin signaling pathway
    106613111
   04068 FoxO signaling pathway
    106613111
   04150 mTOR signaling pathway
    106613111
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106613111
  09143 Cell growth and death
   04210 Apoptosis
    106613111
   04218 Cellular senescence
    106613111
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106613111
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106613111
   04625 C-type lectin receptor signaling pathway
    106613111
  09152 Endocrine system
   04910 Insulin signaling pathway
    106613111
   04920 Adipocytokine signaling pathway
    106613111
   04914 Progesterone-mediated oocyte maturation
    106613111
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106613111
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106613111
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106613111
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106613111
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106613111
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   106613111
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 106613111
NCBI-ProteinID: XP_014070517
UniProt: A0A1S3T1R3
LinkDB
Position
ssa09
AA seq 394 aa
STLNSLSPSREEWMRAIQAVANGLKTRVEEAPMDITFGSPSDCSGMEEMEVAMSKSRNKV
TMSDFDYLKLLGKGTFGKVILVKEKATGMYYAMKILRKEVIIAKDEVAHTVTESRVLQNT
RHPFLTTLKYAFQTHDRLCFVMEYANGGELFFHLSRDRVFTEDRARFYGAEIVSALEYLH
SRDVVYRDLKLENLMLDKDGHIKITDFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDY
GRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPKNLAPEAKALLAGLLKK
DPKQRLGGGQEDAKDVMTQKFFISINWQDVVERKLLPPFKPQVTSETDTRYFDDEFTAQT
ITVTPPDKYDSLDSEDQNQRTHFPQFSYSASIRE
NT seq 1185 nt   +upstreamnt  +downstreamnt
tctacattgaactccctctccccttccagggaggaatggatgcgggcgatccaagcggtg
gccaacggcctaaagacgcgagtggaagaggctcccatggacataacgtttggctccccc
agcgactgcagcggcatggaggagatggaggtggccatgtccaagtcccgcaacaaagtg
accatgagtgattttgactacctgaagctgctggggaagggaacgtttggtaaggtgatc
ctggtgaaggagaaggccacagggatgtactacgccatgaagatcctgaggaaagaagtc
atcatcgctaaggatgaggtagcacacacggtaacagaaagcagagtccttcagaatacg
aggcatcccttcttaacaacactaaaatacgcgttccaaacacatgaccggctatgcttt
gtgatggaatatgcaaacggaggagagctgttctttcacttgtcgcgggaccgcgtgttc
acagaagaccgggcacggttctacggtgcagagattgtgtctgcgctggagtacctccac
tcacgggacgttgtctacagagaccttaagctggagaacttaatgctggataaagatgga
cacataaagatcacagattttggactgtgtaaagagggaatcacagacggggctaccatg
aagaccttttgtggtactccagaataccttgcgcctgaggtattagaggacaatgactac
ggccgagcggtggactggtggggtctgggtgtggtcatgtacgagatgatgtgcggtcga
ctacccttctacaaccaggaccacgagcggttgtttgagctcattctcatggaggagatc
cgcttccccaagaacctggcccccgaagccaaggccctgcttgctggcctgctcaaaaag
gaccccaagcagaggcttggaggtggacaagaagatgccaaagacgtgatgacacagaag
ttcttcatcagcatcaactggcaggatgtggtagagaggaagctcttgcctcccttcaag
ccccaggtgacgtcagagacggacacccgctactttgacgacgagttcacagcacaaacc
atcaccgtaacgcccccggacaagtacgatagcttagactcagaggaccagaaccagcgc
acacacttccctcagttctcttactccgccagcatacgggagtga

DBGET integrated database retrieval system