KEGG   Salmo salar (Atlantic salmon): 100194680Help
Entry
100194680         CDS       T04363                                 

Gene name
lig3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa03410  Base excision repair
Module
sasa_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    100194680 (lig3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sasa03400]
    100194680 (lig3)
Enzymes [BR:sasa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100194680 (lig3)
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     100194680 (lig3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C BRCT_2 RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 100194680
NCBI-ProteinID: XP_014053346
UniProt: A0A1S3RLY7
LinkDB All DBs
Position
ssa04
AA seq 1029 aa AA seqDB search
MQRFCISLALKTVYNIHFGKLCRCQPTWKLFVAYPLSANFQILPHCRGILPYPLDCQQCT
QPPWNRSLSLDSNFKVCWRHYCTNQTDMAEQRYCVEYAKRGTAGCKKCKDKIMKGLTRIG
KIVPNPFSESAGEMKEWYHVKCIFEKLERARATTKKIEDITDLEGWEELQDEDKELINKL
VEDLMAKANASPKKKVQAKLNNSGQLSALPADPSLNAPRKFSGFTATKAGSSGSPGPSPA
KPNQGSPLSAQLCDPKHKDNLLREFRKLCAMVADKNSYNIKTQIIHDFLKKGSGGDKFKG
DVYLTVKLLLPGVVKSVYNLNDKQIVKLFSRIFNCNQEEMVRDLEQGDVSETVRMFFEEG
KSFPPAAKSLLTIQEVDASLTRLAQLTKEDDQQKELEDISKKCTGNDLKCIIRLIKHDLK
MNSGAKHVLDAVDPNAYDAFKASRNLGDVIERVLRNQQDATNGSGPRKLLTIEASLMTPV
QPMLAEACKSIQYAMKKCPNGMYSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAHF
KEFIPQAFVGGNSMILDAEVLLIDTNTSKPLPFGTLGVHKKAAFEDAKVCLFVFDCIYFN
GVSLMEKPLYERRKFLHDNMVEVPNRILFSEMKHVTRAADLAEMITRVIREGLEGLVLKD
LKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGKGSNGGIMSSFLMGCYDPNSK
KWCTVTKCSGGYDDAMLTRLQKELDMIKISKEPSKIPGWLKIIKNYYPDFIIRDPEKAPV
WEITGAEFSKSEMHTADGISIRFPRMTRVRDDKDWKSATNLMQLKELFRISKERCDFEVT
AGPSKGGEDDKGSSGDSGSNSPPSTSQRPVTPRKTSTGNSNTPKAKAVKTEPPSPVLATK
RKMPSEGPSAKKVKTETVHHSNGQSKNGQSKTKMTPSKLVEPRNDKTFCSPQTLLDIFSG
VKLVLPDSVQDHTKLRRYFLAYDGDLVPEYDAASATHTLTEPEEDSHAQRVTPGWIWECI
RKRRVVPPC
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atgcagagattctgtatttcattggcacttaagactgtctacaatatacattttgggaaa
ctgtgtaggtgtcaacccacctggaaactgtttgtcgcttatcccttatctgcaaacttc
caaattctaccccattgtaggggcatcctcccctatcccttggactgccaacagtgcacc
cagcccccttggaatcgcagtctttcactagattccaatttcaaggtttgctggcgtcac
tattgtactaaccagacagacatggctgaacagagatactgtgtagagtatgccaaacgt
ggcactgcgggatgtaagaagtgtaaggacaaaatcatgaagggcttgacccgcatcggg
aagattgtgcctaacccgttcagtgagtccgccggggagatgaaggagtggtaccatgtg
aagtgtatctttgagaagctggagcgggcccgtgccaccactaagaagatcgaggacatc
acagacctggagggctgggaggagctgcaggatgaggacaaggagctcatcaacaaactt
gttgaagacttgatggccaaagctaacgcgagcccaaagaagaaggtgcaagccaagctg
aacaacagtggtcagctgtctgctctgcctgctgacccttctctgaatgcaccacggaag
ttctctggcttcacagctactaaggctgggagctcaggcagcccaggcccctccccagcc
aaacccaaccaaggcagtcctctttccgcacagctctgtgaccccaaacacaaggataac
ctgctccgggagttccgcaagctctgtgccatggtggcagacaagaatagctacaacatc
aagacacagatcatccacgacttcctgaagaaaggctcagggggagataaattcaaggga
gatgtgtacctgacggtgaagctgcttctcccaggggtggtgaagagtgtgtacaacctc
aacgacaaacagatagtcaagctattcagccgcatcttcaactgcaaccaggaggagatg
gtgcgagatctggaacagggggatgtgtcggagacagtgaggatgttttttgaagaaggc
aagtctttcccgccggccgccaagagtctgctcacgattcaggaagtggatgcgtccctt
acccgtctggcccagttaaccaaggaggatgaccagcagaaagagctagaggacatatcc
aaaaaatgcaccggcaatgacctgaaatgtatcatcagactcattaagcatgatctaaag
atgaactctggagctaagcatgtcttggatgcagtggacccgaatgcctacgacgctttc
aaggcctcccgtaacctaggggacgtgatagagcgtgtgctgaggaaccagcaggacgcc
accaacggctcaggccccaggaagctcctcactattgaagcctccctcatgaccccagtg
cagcctatgctggctgaggcatgcaagtccatccagtacgccatgaagaagtgccccaac
ggcatgtactctgaaatcaagtacgacggcgagcgtgtgcaggtccacaagaatggagac
cacttcagctacttcagccgcagccttaaacctgttttgccacacaaggtggcccatttt
aaagagttcatccctcaggcctttgttggtggcaacagcatgatcctggatgccgaggtg
ctcctcatcgacaccaacaccagcaagccactgcccttcgggacactgggggtgcacaag
aaagcagccttcgaagacgccaaagtgtgcttgtttgtgttcgactgcatctatttcaac
ggcgtgagcctgatggagaagcccctgtacgaacgaaggaagttcctccatgacaacatg
gtggaggttcccaacaggatcctgttctccgagatgaagcacgtcactagggcggctgac
ctggccgagatgatcacacgggtcatcagagagggactggaggggctggtcctcaaagac
ctcaagggcacctatgagccagggaagcgccactggctgaaggtaaagaaggactacctg
aacgagggagcaatggctgacacagcagacctggtggtgctgggagccttctatggcaaa
ggctcaaacggcgggataatgtccagtttcttaatgggctgctatgaccccaactctaag
aagtggtgcaccgtgaccaagtgctccggaggctacgatgacgccatgttgacccgactc
cagaaggagctggacatgatcaaaatcagcaaggaacccagtaaaatccctggctggttg
aaaatcatcaagaactattaccctgattttattatccgcgatcccgagaaagcgccggtg
tgggagatcacgggggcggagttctccaagtcggagatgcacaccgccgacggcatatcc
atccgcttcccccgcatgacgcgtgtccgtgacgacaaggactggaagagtgcaaccaac
ctgatgcagctcaaagagctcttccgcatctccaaggagaggtgtgactttgaggtgaca
gccgggccctccaaaggaggtgaggatgacaagggctcttcaggagacagtgggagcaac
tctccaccctccacctcccagaggccagtcacgcccagaaagaccagcacaggcaacagc
aatacccccaaagctaaggcagtgaagacggagcctccctcccctgttctagcaaccaag
aggaaaatgccctcagaagggcccagcgcaaagaaggtaaagactgaaactgtccatcac
agtaatggacaaagcaagaatggacaaagcaagactaagatgaccccctccaagttggta
gaacccaggaatgacaagactttctgctctccccagactctactggacattttcagtggg
gtgaagcttgtcctgccagactctgtgcaggaccacaccaagctgcggcgctactttctg
gcctacgacggggacctggtgccggagtatgacgccgcctcggccacacacaccctgact
gagcccgaggaggacagccatgcccagagagtcacccccggctggatctgggagtgtatc
cgcaagagacgggtggtgcctccctgctga

DBGET integrated database retrieval system