KEGG   Salmo salar (Atlantic salmon): 100194780
Entry
100194780         CDS       T04363                                 

Gene name
mp2k2
Definition
(RefSeq) Dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04270  Vascular smooth muscle contraction
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04540  Gap junction
sasa04620  Toll-like receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04916  Melanogenesis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100194780 (mp2k2)
   04012 ErbB signaling pathway
    100194780 (mp2k2)
   04370 VEGF signaling pathway
    100194780 (mp2k2)
   04371 Apelin signaling pathway
    100194780 (mp2k2)
   04068 FoxO signaling pathway
    100194780 (mp2k2)
   04150 mTOR signaling pathway
    100194780 (mp2k2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100194780 (mp2k2)
  09143 Cell growth and death
   04210 Apoptosis
    100194780 (mp2k2)
   04218 Cellular senescence
    100194780 (mp2k2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100194780 (mp2k2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100194780 (mp2k2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100194780 (mp2k2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100194780 (mp2k2)
   04912 GnRH signaling pathway
    100194780 (mp2k2)
   04916 Melanogenesis
    100194780 (mp2k2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100194780 (mp2k2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100194780 (mp2k2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    100194780 (mp2k2)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100194780 (mp2k2)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE7 family
   100194780 (mp2k2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 100194780
NCBI-ProteinID: NP_001133281
UniProt: B5X0Y3
LinkDB
Position
ssa23
AA seq 401 aa
MAPKRRPVPLNITPIGEGQSISTTIDAASEANLEALQKKLGELDLDEQQRKRLEAFLTQK
AQVGELKDDDFHPICELGAGNGGVVNKVRHKPSRLVMARKLIHLEIKPAIRNQIIRELQV
LHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEARRIPEEILGKVSIAVLRGL
AYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQG
THYSVQSDVWSMGLSLVELAIGRYPIPPPDAKELEAIFGRPVQDGAEGEPQAPSNRLPRP
PGGRPVSGHGMDSRPAMAIFELLDYIVNEPPPRLPLGVFTNDFQEFVTKCLIKNPAERAD
LKMLMNHTFIKRAEVEEVDFAGWMCKTMGLNQPSTPTRITE
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggctccgaagagaagacccgttcccctaaatatcacgcccattggagaggggcagtcc
atctccacgaccatcgatgctgcgtccgaagccaatctggaggccttacagaagaagcta
ggtgagctagatttggatgaacagcagaggaaacgcctggaggctttcctcacccagaaa
gcccaagtgggcgagctgaaagatgatgatttccaccccatatgtgagctgggcgctggc
aacggtggagtggtcaacaaggtccgccacaaaccctccagactggtcatggcccggaag
ctcatccacctggagattaagcctgccatcaggaaccagatcatcagagagctgcaggtg
ctccatgagtgtaactctccctacatcgtgggcttctacggggccttctacagcgatgga
gagatcagtatctgtatggagcacatggatggaggctctctggatcaggtactgaaggaa
gccaggagaatccctgaggagatcctgggcaaagtcagcatagcagtactcagaggactt
gcctatctgcgggaaaagcaccagatcatgcacagagacgtcaagccctccaacatcctg
gtgaactcgcgcggggagatcaagctgtgtgactttggcgtgagtggccagctcatcgac
tccatggccaactccttcgtgggaacgcgctcctacatgtcgccggagagactgcagggc
acacactactctgtgcagtcagacgtgtggagcatgggcctgtccctggtggagctggcc
atcggccgctaccccatccccccgcctgacgccaaggagctggaagccatctttggccgg
ccagtacaggatggagctgagggggaaccacaggccccctccaaccgcctccccagacca
ccaggaggacgaccagtcagcggacatgggatggacagtcgacctgccatggcgatattt
gagctactggactacattgtcaatgagcctcctcccaggcttccactcggtgtcttcacc
aacgatttccaggagtttgtaacaaaatgtctgatcaagaatccagcggagagagctgac
ctgaagatgctgatgaaccacacgtttatcaagcgtgctgaggtggaggaggtggacttt
gctggctggatgtgtaaaaccatgggcctcaaccaacccagcaccccaacccgcatcaca
gaatga

KEGG   Salmo salar (Atlantic salmon): 106569535
Entry
106569535         CDS       T04363                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2-like
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04270  Vascular smooth muscle contraction
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04540  Gap junction
sasa04620  Toll-like receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04916  Melanogenesis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106569535
   04012 ErbB signaling pathway
    106569535
   04370 VEGF signaling pathway
    106569535
   04371 Apelin signaling pathway
    106569535
   04068 FoxO signaling pathway
    106569535
   04150 mTOR signaling pathway
    106569535
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106569535
  09143 Cell growth and death
   04210 Apoptosis
    106569535
   04218 Cellular senescence
    106569535
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106569535
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106569535
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106569535
  09152 Endocrine system
   04910 Insulin signaling pathway
    106569535
   04912 GnRH signaling pathway
    106569535
   04916 Melanogenesis
    106569535
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106569535
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106569535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106569535
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     106569535
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE7 family
   106569535
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Kdo Seadorna_VP7
Other DBs
NCBI-GeneID: 106569535
NCBI-ProteinID: XP_013996464
UniProt: A0A1S3M0B4
LinkDB
Position
ssa14
AA seq 399 aa
MAPKKRPVRLNITPTAGEGGLSTSTTIAAASDANLEALQKKLEELDLDEQQKKRLENFLT
QKAKVGELKDDDFHRICELGVGNGGVVNKVCHKPSGLVMARKLIHLEIKPAIRNQIIREL
QLLHECNSPYIVSFYGSFYSDGEISICMEHMDGGSLDQVLKEARRIPEEILGKVSIAVLR
GLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERL
QGTHYSVQSDVWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPIMDGTEGEIHSSTSPRP
RPPGGRPASGHGPAMAIFELLDYIVNEPPPKLPHGVFTSDFQDFVTRCLIKNPADRADLK
MLMNHTFIKRSEVEEMDFAGWLCKTMALNQPSTPTRTAD
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcccccaaaaaaagaccagtgcgccttaacatcacgcccaccgctggtgagggagga
ttgtccacctccacaaccatcgcagctgcctctgatgctaacctggaggccctacagaag
aagttggaggagttggatctggacgagcagcagaagaagcgcctggagaatttccttacc
cagaaggccaaggtgggcgaactgaaagatgatgacttccaccgcatttgtgagttgggt
gtcggcaacggaggcgtggtcaacaaggtgtgccacaaaccctcaggcctcgtcatggcc
agaaagctgatccatctggagatcaagccagccatcaggaaccagatcatcagagagcta
cagttgctacatgagtgtaattctccctacatcgttagtttctacgggtccttctacagc
gacggagagatcagcatctgcatggaacacatggatgggggctctctggaccaggtgctg
aaggaggccaggaggatccctgaggagatcctggggaaagtcagcatcgctgttctaaga
gggttagcgtatctacgagagaaacaccagatcatgcacagagacgtaaagccctctaat
atcctggtcaactctcgtggggagatcaagctgtgtgacttcggggtgagcggccagctg
atagactccatggccaactccttcgtgggaacacgttcctacatgtcgccggagagattg
cagggcacccactactcagtccagtctgatgtgtggagcatggggctgtctctggtggag
ctgtctatcggccggtatcccatcccccctcctgacgccaaggagctggaggccatcttt
ggccggcccatcatggacgggaccgagggagaaatccacagcagcacctctccccgaccc
agaccccccgggggcagacctgccagcggccacggtcctgcgatggccatctttgagctg
ttggactacatcgtcaacgagcctccccccaaactgcctcatggagtattcacatctgat
ttccaggactttgtgactagatgtctcatcaagaacccagcagaccgggcggacctgaag
atgctgatgaaccacacttttatcaagcgctcggaggtagaggagatggacttcgctggc
tggctctgtaaaaccatggcgctgaaccaacccagcactcccacacgcactgcagactaa

KEGG   Salmo salar (Atlantic salmon): 106584829
Entry
106584829         CDS       T04363                                 

Gene name
map2k1
Definition
(RefSeq) mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04114  Oocyte meiosis
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04270  Vascular smooth muscle contraction
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04620  Toll-like receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106584829 (map2k1)
   04012 ErbB signaling pathway
    106584829 (map2k1)
   04370 VEGF signaling pathway
    106584829 (map2k1)
   04371 Apelin signaling pathway
    106584829 (map2k1)
   04068 FoxO signaling pathway
    106584829 (map2k1)
   04150 mTOR signaling pathway
    106584829 (map2k1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106584829 (map2k1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    106584829 (map2k1)
   04210 Apoptosis
    106584829 (map2k1)
   04218 Cellular senescence
    106584829 (map2k1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106584829 (map2k1)
   04540 Gap junction
    106584829 (map2k1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106584829 (map2k1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106584829 (map2k1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    106584829 (map2k1)
   04912 GnRH signaling pathway
    106584829 (map2k1)
   04914 Progesterone-mediated oocyte maturation
    106584829 (map2k1)
   04916 Melanogenesis
    106584829 (map2k1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106584829 (map2k1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106584829 (map2k1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106584829 (map2k1)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     106584829 (map2k1)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE7 family
   106584829 (map2k1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7
Other DBs
NCBI-GeneID: 106584829
NCBI-ProteinID: XP_014025901
UniProt: A0A1S3PE66
LinkDB
Position
ssa23
AA seq 345 aa
MYYCCVEVLYAEVLCAEVLYAEVLYAEVLCAEVLYAEVLYAEVLCAEVLYAEVLCAEVLC
AEVLYAEVLYAEVLCAEVLYAEVLYAEVLCAEVLCAEVLYAEVLYAEVLYADVLYAEVLY
AEVIKGLSYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYM
SPERLQGTHYSVQSDIWSMGLSLVEMAVGRFPIPPPDARELEVIFGFPVEGEPCSSDITS
PKPRPPGRPGSSCGPDSRPPMAIFELLDYIVNEPPPKLPGIFGAEFQDFVNKCLIKNPAD
RADLKQLMVHQFIKLSEAEEVDFAGWLCSTIGLNQPVTPTHSVGM
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgtattactgctgtgttgaggtgctgtatgctgaggtgctgtgtgctgaggtgctgtat
gctgaggtgctgtatgctgaggtgctgtgtgctgaggtgctgtatgctgaggtgctgtat
gctgaggtgctgtgtgctgaggtgctgtatgctgaggtgctgtgtgctgaggtgctgtgt
gctgaggtgctgtatgctgaggtgctgtatgctgaggtgctgtgtgctgaggtgctgtat
gctgaggtgctgtatgctgaggtgctgtgtgctgaggtgctgtgtgctgaggtgctgtat
gctgaggtgctgtatgctgaggtgctgtatgctgatgtgctgtatgctgaggtgctgtat
gctgaggtgattaaaggcctgtcctacctgagagagaaacataagatcatgcatcgagat
gtgaagccatctaacatccttgttaactcacgtggtgagatcaagctgtgtgactttgga
gtgagcggtcagctcatcgactccatggccaattccttcgtgggaactcgctcctacatg
tctccagagcgtctccagggaacccactactctgtccagtctgatatctggagtatgggt
ctgtctctggttgagatggctgtcggacgctttcccatccctccccccgacgcccgcgaa
ctggaagtgatctttgggttcccggtggagggagaaccctgttctagtgacatcacttcc
cccaagcccagaccccccggacggccaggcagctcctgtgggccagacagcagacctcct
atggcgatttttgaactgctggactacatagtcaatgagcctcctcctaagctgcctggt
attttcggagctgaatttcaagactttgtgaataaatgtttgatcaagaacccagcagac
agggcagacctgaagcagttgatggttcatcaattcatcaagctgtcagaggcagaggag
gtggactttgcaggctggctgtgtagcaccattggactcaaccagccagtcaccccaaca
cacagtgtgggcatgtga

KEGG   Salmo salar (Atlantic salmon): 106600441
Entry
106600441         CDS       T04363                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2-like
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04270  Vascular smooth muscle contraction
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04540  Gap junction
sasa04620  Toll-like receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04916  Melanogenesis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106600441
   04012 ErbB signaling pathway
    106600441
   04370 VEGF signaling pathway
    106600441
   04371 Apelin signaling pathway
    106600441
   04068 FoxO signaling pathway
    106600441
   04150 mTOR signaling pathway
    106600441
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106600441
  09143 Cell growth and death
   04210 Apoptosis
    106600441
   04218 Cellular senescence
    106600441
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106600441
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106600441
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106600441
  09152 Endocrine system
   04910 Insulin signaling pathway
    106600441
   04912 GnRH signaling pathway
    106600441
   04916 Melanogenesis
    106600441
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106600441
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106600441
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106600441
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     106600441
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE7 family
   106600441
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 APH
Other DBs
NCBI-GeneID: 106600441
NCBI-ProteinID: XP_014047273
UniProt: A0A1S3R4I6
LinkDB
Position
ssa03
AA seq 374 aa
MDCEVQIITCANLEALQKKLEEMDLDEQQKKRLEAFLTQKAKVRELKDDDFHHICELGAG
NGGVVNKVCHKPSGLVMARKLIHLEIKPAIRNQIIRELQLLHECNSPYIVSFYGAFYSDE
EISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREEHQIMHRDVKPSNIL
VNSCGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHFSVQSDVWSMGLSLVELS
IGRYPIPPPDTKELEIIFGQPMDGAEGDMHSSTSPRSPGGRHASSHGPEMAIFELLDYIV
NEPPPELPHGVFTSDFHDFVTRCLIKNPTDRADVKMLMNHTFIKRSEVEVVDFAGWLCKI
MALNQPSTPPCTAD
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggattgtgaagtccagattatcacatgcgctaacctggaggccctacagaagaagctg
gaagagatggatctagatgagcagcagaagaagcgcttggaggctttcctgacccagaaa
gccaaagtgcgcgagctgaaagacgatgacttccaccacatctgtgagctgggcgctggc
aacggaggtgtggtcaacaaggtgtgccacaaaccctcaggcctggtcatggccagaaag
ctgatccatctggagatcaagccagccatcagaaaccagatcatcagagagctacagttg
ctacatgagtgtaactcgccctacatcgttagtttctacggggccttctacagcgacgaa
gaaattagcatctgcatggaacacatggatgggggctccctggaccaggtgctgaaggag
gccaagaggatccctgaggagatcctagggaaagtcagcattgctgttctcagaggttta
gcctatctacgagaagaacatcagatcatgcacagagatgtgaagccctctaacatcctg
gtgaactcttgtggggagatcaagctgtgtgactttggcgtgagtggacagctcatagac
tccatggccaactccttcgtgggaacacgctcctacatgtcgccggagcgattgcagggc
acccacttctctgttcagtctgacgtgtggagcatgggcctgtctctggtggagctgtct
atcggccggtaccccatcccccctcctgacaccaaggagcttgagatcatcttcggacag
cccatggatggggctgagggagacatgcacagcagcacctcacccagatcccctgggggc
agacatgctagcagccatggtcctgagatggccatctttgagctgctggactacattgtc
aacgagcctccccccgaactgccccatggcgtattcacttctgatttccatgactttgtg
actagatgtctcatcaagaacccaacagaccgggctgacgtgaagatgctgatgaaccac
acgtttatcaagcgctctgaggtagaggtggtggactttgctggctggctctgtaaaatc
atggcactgaaccaacccagcactcccccatgcactgcagactag

KEGG   Salmo salar (Atlantic salmon): 106613775
Entry
106613775         CDS       T04363                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04270  Vascular smooth muscle contraction
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04540  Gap junction
sasa04620  Toll-like receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04916  Melanogenesis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106613775
   04012 ErbB signaling pathway
    106613775
   04370 VEGF signaling pathway
    106613775
   04371 Apelin signaling pathway
    106613775
   04068 FoxO signaling pathway
    106613775
   04150 mTOR signaling pathway
    106613775
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106613775
  09143 Cell growth and death
   04210 Apoptosis
    106613775
   04218 Cellular senescence
    106613775
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106613775
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106613775
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106613775
  09152 Endocrine system
   04910 Insulin signaling pathway
    106613775
   04912 GnRH signaling pathway
    106613775
   04916 Melanogenesis
    106613775
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106613775
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106613775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106613775
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     106613775
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE7 family
   106613775
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 106613775
NCBI-ProteinID: XP_014071856
UniProt: A0A1S3T5J0
LinkDB
Position
ssa10
AA seq 401 aa
MAPKRRPVPLNITPIGEGQSISTTIDAASEANLEALQKKLGELDLDEQQRKRLEAFLTQK
AQVGELKDDDFHPICELGAGNGGVVNKVRHKPSRLVMARKLIHLEIKPAIRNQIIRELQV
LHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEARRIPEEILGKVSIAVLRGL
AYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQG
THYSVQSDVWSMGLSLVELAIGRYPIPPPDAKELEAIFGRPVQDGAEGEPHTISNRLPRP
PGGRPVSGHGMDSRPAMAIFELLDYIVNEPPPRLPLGVFTNDFNEFVTKCLIKNPAERAD
LKMLMNHTFIKRAEVEEVDFAGWMCKTMGLNQPSTPTRGTE
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggctccgaagagaagacccgttcccctaaatatcacgcccattggagaggggcagtcc
atctccacaaccatcgatgctgcgtccgaagccaatctggaggccttacagaagaagcta
ggtgagctagatttggacgaacagcagaggaaacgcctggaggctttcctcacccagaaa
gcccaagtgggcgagctgaaagatgatgatttccaccccatatgtgagctgggcgctggc
aacggtggagtggtcaacaaggtccgccacaaaccctccagactggtcatggcccgaaag
ctcatccacctggagattaagcctgccatcaggaaccagatcatcagagagctgcaggtg
ctgcatgaatgcaactctccctacatcgtgggcttctacggggccttctacagcgatgga
gagatcagtatctgcatggagcacatggatggaggctctctggatcaggtgctgaaggaa
gccaggagaatccctgaggagatcttgggaaaagtcagcatagcagtactccgaggactt
gcctatctgcgggagaagcaccagatcatgcacagagacgtcaagccctccaacatcctg
gtgaactcgcgcggggagatcaagctgtgtgacttcggcgtgagtggccaactcatcgac
tccatggccaactccttcgtgggaacgcgctcctacatgtcgccggagagactgcagggc
acacactactctgtgcagtcggacgtgtggagcatgggcctgtccctggtggagctggcc
atcggccgctaccccatccccccgcctgatgccaaggagctggaggccatctttggccgg
cccgtacaggacggagctgagggggaaccacacaccatctccaaccgtctccccagacca
ccaggagggcgaccagtcagcggacatgggatggacagtcgaccagccatggcgatattt
gagctgctggactacattgtcaatgagcctcctcccaggctgccacttggtgtcttcacc
aacgatttcaacgagtttgtgacaaaatgtctgatcaagaatccagcagagcgagctgac
ctgaagatgctcatgaaccacacgtttatcaagcgtgctgaggtggaggaggtggacttc
gctggctggatgtgtaaaaccatgggcctcaaccaacccagtacccccacccgtggcact
gaatga

DBGET integrated database retrieval system