KEGG   Salmo salar (Atlantic salmon): 100194892
Entry
100194892         CDS       T04363                                 

Gene name
casp3
Definition
(RefSeq) Caspase-3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100194892 (casp3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100194892 (casp3)
   04115 p53 signaling pathway
    100194892 (casp3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100194892 (casp3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100194892 (casp3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    100194892 (casp3)
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     100194892 (casp3)
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C14: caspase family
   100194892 (casp3)
SSDB
Motif
Pfam: Peptidase_C14 Ham1p_like
Other DBs
NCBI-GeneID: 100194892
NCBI-ProteinID: NP_001133393
UniProt: Q4ZHV0
LinkDB
Position
ssa24
AA seq 279 aa
MSDLVDAKGIAAQGLGSPSVQRFTTENPEVDAKPPADMYTYKMNYPSLGQCVIINNKNFD
KQTGMSFRNGTDVDAGHAIKVFSSLGYKVKVANDQTVQQIQQLLSKVSQDDHSQSASFVC
VMLSHGEEGFFYGTDGNVELKKLTGLFRGDRCKTLVGKPKLFFIQACRGDNLDGGIETDA
VADDSPERIPVEADFLYAYSTAPGYYSWRNTQKGSWFVQALCEMLQRYGKQLEIMQIMTR
VNHMVALDFESISNMPGFTAKKQIPCIVSMLTKDLYFPH
NT seq 840 nt   +upstreamnt  +downstreamnt
atgtctgatttggtggatgccaaagggatagctgcacaagggctgggcagtccctcagtg
caaaggtttacgacagagaatcctgaagtagacgctaagcctccggctgacatgtacaca
tataagatgaactaccccagccttggtcagtgtgtcatcatcaacaacaagaactttgac
aagcaaacaggaatgagctttcgcaatggaacagacgtggatgcaggacatgcgatcaaa
gtgttctcgagtttggggtacaaagtgaaggttgccaatgaccagactgtgcaacagata
caacagctgctttccaaagtgtctcaagacgaccacagccagtccgcctcctttgtgtgt
gtgatgctgagccatggagaagaggggttcttctatggcacagatggcaatgtagaactc
aagaagctcactggcctctttaggggcgaccgctgcaaaacgctggtgggcaagcccaaa
ctcttcttcatccaggcgtgccgtggcgataacctggatggtggcatagagacagacgcc
gttgctgatgactctccagagaggattcctgttgaggcagactttctctacgcttattct
acagccccaggctactactcctggaggaacacccagaagggctcctggttcgtgcaggcc
ctctgtgagatgttacaaaggtacggcaaacagctggagatcatgcagatcatgacacgt
gtcaaccacatggtggcacttgacttcgagtctatctccaacatgcctggctttactgcc
aaaaagcagatcccttgcattgtgtctatgttgaccaaagatctctactttccacattga

KEGG   Salmo salar (Atlantic salmon): 106602722
Entry
106602722         CDS       T04363                                 

Gene name
CASP3
Definition
(RefSeq) caspase-3-like
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106602722 (CASP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106602722 (CASP3)
   04115 p53 signaling pathway
    106602722 (CASP3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106602722 (CASP3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106602722 (CASP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106602722 (CASP3)
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     106602722 (CASP3)
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C14: caspase family
   106602722 (CASP3)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 106602722
NCBI-ProteinID: XP_014051013
UniProt: C0HBK4
LinkDB
Position
ssa04
AA seq 284 aa
MSAANDLSAGDCVDARRGDGQESEGPCGGSGSMQVDAKPQSHSFRYSLSYPSIGQCIIIN
NKNFDRRTGMNVRNGTDVDAGNVMKVFGKLGYKVKVYNDQTVDQIKHVLTTASKEDHSCS
ASFVCVLLSHGDDGVFFGTDASIELKSLTSLFRGDRCNSLVGKPKLFFIQACRGTDLDRG
IEADSSSDGSSTRIPVEADFLYAYSTAPGYYSWRNTQTGSWFIQSLCEMIGKYSKELEVQ
HILTRVNHKVATEFESASNSPGFDAKKQIPCIVSMLTKEMYFTP
NT seq 855 nt   +upstreamnt  +downstreamnt
atgtcagcagcaaacgatttgagtgctggggactgcgttgacgctaggcggggcgatgga
caagagtcagagggcccctgtggtggctctgggtctatgcaggtggatgccaagcctcag
tcccatagcttcaggtacagcctcagctaccccagcattggccagtgtatcatcattaac
aacaagaactttgacagaagaacaggtatgaatgtacgcaatggcacagatgtggatgca
ggcaacgtgatgaaggtgtttgggaaactgggttataaggtgaaggtttacaatgaccag
acagtggaccagatcaagcatgttttaaccacagcctccaaggaggaccacagctgctcc
gcttcattcgtgtgtgtcctgctgagtcacggggatgatggtgtgttcttcgggacggat
gcctccatcgagctcaagagcctcaccagcctgttccggggcgaccgctgcaactcgctg
gtgggcaagcccaaactcttcttcatccaggcttgcagaggtactgatctggacaggggc
atcgaggcagacagcagttcagatgggagttcgaccaggatccctgtggaagcagacttc
ctctatgcctactccacagctccaggctactactcatggaggaacactcagactggctcc
tggtttatccaatctctgtgtgagatgattggcaaatacagcaaagagctagaggtccaa
cacatcctgacccgggtcaaccacaaggtggcgacagagtttgagtctgcgtcaaactct
cccggcttcgatgccaagaagcagatcccttgcattgtatcaatgctgaccaaagagatg
tactttacaccctga

KEGG   Salmo salar (Atlantic salmon): 106612018
Entry
106612018         CDS       T04363                                 

Definition
(RefSeq) caspase-3-like
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106612018
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106612018
   04115 p53 signaling pathway
    106612018
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106612018
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106612018
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106612018
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     106612018
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C14: caspase family
   106612018
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 106612018
NCBI-ProteinID: XP_014068261
UniProt: A0A1S3SV99
LinkDB
Position
ssa09
AA seq 283 aa
MSDLVDAKCIAAQGPGNPSVPRFTIEHHKVDARPPADMFTYKMNYPSLGQCVIINNKNFD
RRTGMSSREGTDVDAGYARKVFERLGYNVKVANDQTVQQIRQLLYTVSQVDHSQSASFVC
VMLSHGGEGVFYGTDGHVELQKLTGLFRGDRCKTLVGKPKLFFIQACRGTDLDCGIETDS
VAGGIETDSFAGDYPVRIPVEADFLYAYSTAPGYYSWRNIDKGSWFIQALCEMLQRYGKQ
LDIMHIMTRVNHKVAHDFEVSVNAHKQIPCIVSMLTKHLYFPH
NT seq 852 nt   +upstreamnt  +downstreamnt
atgtctgatttggtggatgccaaatgcatagctgcacaagggccagggaacccctcagtg
ccaaggtttactattgagcatcataaagtagatgctaggcctccagctgacatgttcaca
tataaaatgaactatcccagccttggacaatgtgtcatcatcaacaacaagaactttgac
aggagaacaggaatgagttctcgcgagggaaccgatgtggacgctggctatgcaaggaaa
gtgtttgaacgtttggggtacaacgtgaaagttgccaatgaccagacggtgcagcagatc
cgacagctgctttacactgtgtctcaagttgaccacagccagtcggcctcctttgtgtgt
gtgatgctgagccatggaggcgagggggtgttctatggcacagatggacatgtggagctc
cagaagctcaccggactcttcaggggcgaccgctgcaaaacgctggtgggaaagcccaaa
ctcttcttcatccaggcgtgccgtggcactgatctggactgtggaatagagacagacagt
gttgctggtggaatagagacggacagctttgctggtgactatccagtgaggattccagtg
gaggcagactttctctatgcttactctacagccccaggctactactcctggaggaacatc
gacaagggctcctggttcatccaggccctctgtgagatgttacaaaggtacggaaaacag
ctggacattatgcacatcatgacacgtgtcaaccacaaggtggcacatgacttcgaggtt
tctgtcaatgcccacaagcagatcccttgcattgtgtctatgttgaccaaacatctctac
tttccacattga

DBGET integrated database retrieval system