KEGG   Salmo salar (Atlantic salmon): 100194937
Entry
100194937         CDS       T04363                                 

Gene name
ccng2
Definition
(RefSeq) cyclin G2
  KO
K10146  cyclin G2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100194937 (ccng2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100194937 (ccng2)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 100194937
NCBI-ProteinID: NP_001133438
UniProt: B5X1Q0
LinkDB
Position
ssa24
AA seq 337 aa
MQDLQYLDNETCWLVKELKSNISQESYFLPRETGLNIMESAAENHNGVSAKCRNAKVEDL
WSLTSFFGFSTQTFVLAVNLLDRFLAIMKVQPKHLPCIGVSCLHIAAKMVEDECNISPTH
ELIRISQSKFTVSDLSRMEKIISGKLNLELKAVTALTFLHLYHAVIVSLTSEREEIPSIG
RLEAQLKACLCRLVFSKAKPSVLALSVICQEFEALQSLAMLEIVQEVQRHLKIVDSELLY
WRGLVAKCMTEYSSSECNKPDNKKLVWIVSRRTAQNLHANNFSVPELPTIPEGSWGESES
EDSCEDMSCEEDSPCSSPGSDEKGPFFPVEFHNQGRK
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgcaggatcttcaataccttgacaatgaaacatgttggcttgtcaaagagctgaagtca
aacatttctcaagaatcatactttttacctcgggaaactggcctgaatataatggagtct
gcagcagagaatcacaatggagtctctgcaaaatgcagaaatgccaaagttgaagacttg
tggagcctgaccagtttctttggtttcagcacccagacatttgttctggctgtcaatcta
ctggataggttcttagccattatgaaggtccaacctaagcatctgccttgcattggagtc
tcctgcctccatattgctgccaaaatggttgaggatgagtgtaacatctcacccacccat
gaactcatccgcatcagccaaagcaagttcactgtttctgacctcagccgcatggagaag
atcatctctggaaaactcaatttggagctcaaagccgtcacagccttaacctttttacac
ttataccatgctgtcatcgtatcactaacatcagaaagggaggagatcccaagcattggg
agactggaagcccagcttaaagcctgcttatgtcggcttgttttctctaaagcaaaacca
tcggtgctggcactgtctgtcatttgtcaggagtttgaagccctccagtctcttgccatg
ttggaaattgtccaagaagtccaaaggcacctaaagattgttgacagtgagttactctac
tggaggggacttgtggccaaatgcatgactgagtacagctcaagtgaatgtaacaaacca
gacaacaaaaaactggtgtggatcgtgtccagacgaaccgcccaaaatttgcacgctaat
aacttcagtgtccctgaactgccgaccattccagagggcagctggggtgaaagtgagagt
gaggattcctgtgaggacatgagctgtgaagaggacagcccgtgcagctctcctggcagc
gacgaaaagggacccttcttccccgtagagtttcacaaccagggcagaaaatga

KEGG   Salmo salar (Atlantic salmon): 106568527
Entry
106568527         CDS       T04363                                 

Definition
(RefSeq) cyclin-G2-like
  KO
K10146  cyclin G2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106568527
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106568527
SSDB
Motif
Pfam: Cyclin_N Imm68 Cyclin_C
Other DBs
NCBI-GeneID: 106568527
NCBI-ProteinID: XP_013994423
UniProt: A0A1S3LTV7
LinkDB
Position
ssa13
AA seq 338 aa
MEAVKLMRELKTNFEQEIYYLPKETGLHLIESTRENASQGISAKCRDVKVEDLWSLTSFF
GYSTQTFVLAVNLLDRFLAMMKVQPKHLACISISCLHIAAKTVEEECDVSSTNELIRIGQ
CKFTVSDLTRMEKIISEKLNFQLEAITALTFLHLYHRITLSQTSDRKEALNLNTLEAHLK
ACLCRITFSKAKPSVLALSLLTQEIEAMQSVDMLEIAHSVQRHLKITDTELLHWRGLVAK
CMSDYSSPECSRPNNKKLVWIVSRRTAQNLHTSYCNVPELPTIPEDCWDESEDSCEDMSS
GEESLSSSLGSDAEGPYFPLYFLCQSNQRNKYHHTKPL
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggaagccgttaaacttatgagggagctgaaaaccaattttgaacaggagatttattat
cttccgaaagaaacgggactccacttgatcgaatcaaccagagagaatgccagccaagga
atctcagctaaatgtagggacgtcaaagtggaagacctctggagcctgaccagtttcttt
gggtacagcacccagaccttcgttctggcagtcaacctgctggatagatttttggccatg
atgaaggtccaacccaaacatttagcctgcattagcatcagctgcctccacatcgcagcc
aaaacagtagaagaagagtgcgacgtgtcttccaccaatgagcttattcgtatcggccag
tgcaagtttacagtctcggacctcactcgcatggagaagatcatttcagagaaactcaac
ttccaactcgaagccatcacagccttaacctttttgcacctataccatagaatcacactc
tcacaaacctcagacaggaaggaagccctgaacctgaacacactagaggcccacctcaaa
gcctgtctctgccgcatcacattctccaaagctaaaccatccgtcttggccctgtccctc
ctcactcaagagattgaagccatgcagtctgttgacatgctagaaatagcacatagtgtt
cagagacatctcaagatcactgacactgagctgctacactggagggggctggtggccaag
tgtatgtctgactactcttcccctgaatgtagcagacccaacaataagaagctagtctgg
atcgtgtcgagaaggacagctcagaaccttcacaccagctactgcaacgtccctgaactg
ccaaccattcctgaggactgctgggacgaaagcgaggactcgtgtgaagacatgagttct
ggggaggagagcctgagcagttccctgggatctgatgcagagggaccttacttccctctt
tacttcctctgccaaagcaaccagcgaaacaaataccaccataccaaacccctgtga

KEGG   Salmo salar (Atlantic salmon): 106572117
Entry
106572117         CDS       T04363                                 

Definition
(RefSeq) cyclin-G2-like
  KO
K10146  cyclin G2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106572117
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106572117
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 106572117
NCBI-ProteinID: XP_014001448
UniProt: A0A1S3ME29
LinkDB
Position
ssa01
AA seq 345 aa
METVKLMRELITNFEQERNYLPKETGLRIIESTGENDSRGISAKCRDTKVEDLWSLTSFF
GYSTQTFVLAVNLLDRFLAMMKVQPKHLACIGVSCLHIAAKAVEEECNVSSTNELIRIGQ
CKFTVSDLTRMEKIISEKLNFQLKAITALTFLRLYHGITRAHTSDLKETLNLDTLEVQLK
ACLCRIAFSKAKPSVLALSLLTQEIEAMQSVDMLEIAHHVQRHLKITDFELLHWKGLVAK
CMSDYSSPECSKPNNKKLVWIVSRRTAQNLHTSYYSIPELPTIPEDCWDQSESEDSCEDM
SSGEESLSSSLGSDAEGPYFPLNFLCQKPHNKYHQSPMREPQCLG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggaaacggtgaaacttatgagggagctgataaccaattttgaacaggagaggaattat
cttccgaaggaaacaggactccgcataatcgaatcgactggagagaatgacagcaggggt
atatcagctaaatgtagggacaccaaagtggaggacctctggagcctgactagtttcttt
gggtacagtacacagacttttgttctggctgtcaacctgttggatcgattcctggccatg
atgaaggtccaacccaaacatctagcctgcatcggcgtcagctgcctccacatcgcagcc
aaagcagtcgaagaggagtgtaacgtgtcttccaccaatgagcttattcgtatcggccag
tgcaagtttacggtctcggacctcactcgcatggagaagatcatttcagagaaactcaac
ttccaactcaaagccatcacagccttaacgtttttgcgcctataccacggaatcacaaga
gcccatacctcagacctgaaggagaccctgaacctcgacacactagaggtccagctcaaa
gcctgtctctgccggatcgcgttctccaaagctaaaccgtcagtcttggccctgtcacta
ctcactcaggagattgaagccatgcaatctgttgatatgttagaaatagcacatcatgtt
cagagacatctcaagatcactgactttgagctgctacactggaagggactagtggccaag
tgtatgtccgactactcttctcctgaatgtagcaaacccaacaataagaagcttgtctgg
atcgtgtcgagaaggacagcgcagaaccttcacaccagctactacagcatccctgaactg
ccaaccattcctgaggactgctgggatcagagtgaaagtgaagactcatgtgaagacatg
agttcaggggaggagagtctgagcagttccctgggctctgacgcggagggaccttacttc
cctctaaacttcctctgccaaaaaccccacaacaaataccaccaaagccctatgagggag
ccacagtgcctgggttaa

KEGG   Salmo salar (Atlantic salmon): 106580043
Entry
106580043         CDS       T04363                                 

Definition
(RefSeq) cyclin-G2-like
  KO
K10146  cyclin G2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106580043
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106580043
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 106580043
NCBI-ProteinID: XP_014016082
UniProt: A0A1S3NL07
LinkDB
Position
ssa20
AA seq 353 aa
MDDGSWCKRQTVFKYRMQDLQDLDNETCWLVKELKSYIAQEADFLPRETGLNIMESAAEN
HNGVSAKCRNAKVEDLWSLTSFFGFSTQTFVLAVNLLDRFLAIMKVQPKHLPCIGVSCLH
IAAKMVEDECNISPTHELIRISQSKFTVSDLSRMEKIISGKLNLELKAVTALTFLHLYHA
VIVSLTSERGEIPSIGRLEAQLKACLCQLIFSKAKPSVLALSVITQEFDALQSLAMLEIV
QELKRHLKIVDSELLYWRGLVAKCMTEYSSGECNKPDNKKLVWIVSRRTAQNLHANHFSV
PELPTIPEGSWGESESEDSCEDMSCEEDSLCGSPGSDAEGAFFPSEFCNQGRK
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggatgatggttcatggtgcaaaaggcagactgttttcaaatacaggatgcaggatctt
caagaccttgacaatgaaacatgttggcttgtcaaagagctaaagtcatacattgctcaa
gaagcagactttttaccaagggaaactggcctcaatataatggagtctgcagcagagaat
cacaatggagtctctgcaaaatgcagaaatgccaaagttgaagacctgtggagcctgacc
agtttctttggtttcagcacccagacatttgtcctagctgtcaatctactggataggttc
ttagccattatgaaggtccaacctaagcacttgccctgcattggagtctcctgtctccat
attgctgccaaaatggttgaggacgagtgcaacatctcacccacccatgaactcatccgc
atcagccaaagcaagttcactgtttctgacctcagccgaatggagaagatcatctctgga
aaactcaacttggagctcaaagccgtcacagccttaacctttttacacttataccatgct
gtcattgtatcacttacatcagaaaggggggagatcccaagcattgggagactggaagcc
cagctaaaagcctgcttatgccagcttattttctctaaagcaaaaccatcggtgctggca
ctgtctgtcataactcaggaatttgatgccctccagtctcttgctatgttggaaattgtc
caagaactcaaaaggcacctaaagattgttgacagtgagttactctactggaggggactc
gtggccaaatgcatgactgagtacagctcaggtgaatgtaacaaaccagacaacaaaaaa
ctggtgtggatcgtgtccagacgaaccgcccaaaatttgcacgctaatcacttcagtgtc
cctgaactgccgactattccagagggcagctggggtgaaagtgagagtgaggattcctgt
gaggatatgagctgtgaagaggacagcctgtgcggctctcctggcagtgatgcagaggga
gccttcttcccctcggagttttgcaaccagggcagaaaatga

KEGG   Salmo salar (Atlantic salmon): 106585380
Entry
106585380         CDS       T04363                                 

Definition
(RefSeq) cyclin-G2-like
  KO
K10146  cyclin G2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106585380
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106585380
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 106585380
NCBI-ProteinID: XP_014026996
UniProt: A0A1S3PHC7
LinkDB
Position
ssa24
AA seq 337 aa
MQDLQYLDNETCWLVKELKSNISQESYFLPRETGLNIMESAAENHNGVSAKCRNAKVEDL
WSLTSFFGFSTQTFVLAVNLLDRFLAIMKVQPKHLPCIGVSCLHIAAKMVEDECNISPTH
ELIRISQSKFTVSDLSRMEKIISGKLNLELKAVTALTFLHLYHAVIVSLTSEREEIPSIG
RLEAQLKACLCRLVFSKAKPSVLALSVICQEFEALQSLAMLEIVQEVQRHLKIVDSELLY
WRGLVAKCMTEYSSSECNKPDNKKLVWIVSRRTAQNLHANNFSVPELPTIPEGSWGESES
EDSCEDMSCEEDSPCSSPGSDEKGPFFPVEFRNQGRK
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgcaggatcttcaataccttgacaatgaaacatgttggcttgtcaaagagctgaagtca
aacatttctcaagaatcatactttttacctcgggaaactggcctgaatataatggagtct
gcagcagagaatcacaatggagtctctgcaaaatgcagaaatgccaaagttgaagacttg
tggagcctgaccagtttctttggtttcagcacccagacatttgttctggctgtcaatcta
ctggataggttcttagccattatgaaggtccaacctaagcatctgccttgcattggagtc
tcctgcctccatattgctgccaaaatggttgaggatgagtgtaacatctcacccacccat
gaactcatccgcatcagccaaagcaagttcactgtttctgacctcagccgcatggagaag
atcatctctggaaaactcaatttggagctcaaagccgtcacagccttaacctttttacac
ttataccatgctgtcatcgtatcactaacatcagaaagggaggagatcccaagcattggg
agactggaagcccagcttaaagcctgcttatgtcggcttgttttctctaaagcaaaacca
tcggtgctggcactgtctgtcatttgtcaggagtttgaagccctccagtctcttgccatg
ttggaaattgtccaagaagtccaaaggcacctaaagattgttgacagtgagttactctac
tggaggggacttgtggccaaatgcatgaccgagtacagctcaagtgaatgtaacaaacca
gacaacaaaaaactggtgtggatcgtgtccagacgaaccgcccaaaatttgcacgctaat
aacttcagtgtccctgaactgccgaccattccagagggcagctggggtgaaagtgagagt
gaggattcctgtgaggacatgagctgtgaagaggacagcccgtgcagctctcctggcagc
gacgaaaagggacccttcttccccgtagagtttcgcaaccagggcagaaaatga

KEGG   Salmo salar (Atlantic salmon): 106604232
Entry
106604232         CDS       T04363                                 

Gene name
CCNG1, Cyclin-G1
Definition
(RefSeq) cyclin-G1-like
  KO
K10145  cyclin G1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106604232 (CCNG1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C CobA_CobO_BtuR
Other DBs
NCBI-GeneID: 106604232
NCBI-ProteinID: XP_014054170
UniProt: B5XAC8
LinkDB
Position
ssa05
AA seq 299 aa
MLPTVTGPGALPFAVQLKALTDQEFRYQPKLSGLRIIEMAHDNGLRMTARLREYEVKDLL
SLTRFFGFSAETFSLAINLLDRFLAVMKIQPKHLSCVGLSCFYIAVKTSEEEKNVAMANE
LIRISQNRFTVSDMMRMEKIILEKLYWKVKAPTALHFLRLFYSCIQDTLEDDCKEILNIE
RLEAQLKACHCSFTFSKVKPSLLALSLLALELQEQHDHEHVDKLLNAFQSLQQQLTVREG
DLVIVTELVMKCLIDYSTTRVSRPNSQRLRWILSGRTQRTLKHSYYKIAHMPTIPESAY
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcttcccacagtgactggaccaggggctctgccctttgccgtgcagttgaaggctctg
actgaccaggagttcaggtaccagcccaagctgagcgggctgaggatcattgagatggcc
catgacaacggcctgaggatgaccgcccggctcagggagtacgaggtgaaggacctcctt
tctctgaccaggttctttggcttcagtgcagagaccttctccctggccatcaacctgctg
gaccgcttcctcgctgtcatgaagatccagccgaagcatctgtcatgtgtgggcctgtcc
tgtttctacatcgctgtgaagacctcggaggaggaaaagaatgtcgccatggccaacgag
ctgatccggatcagccagaaccgcttcaccgtgtccgacatgatgaggatggagaagata
attctggagaagctctactggaaggtcaaagcccccaccgccctccacttcctcagactg
ttctacagctgcatacaggacacgctcgaagatgactgcaaggagatcctgaacattgag
agactagaagcccagctgaaagcctgccattgctctttcactttctctaaagtcaagccc
tctctgcttgccctgtccttgttggctctggagcttcaggagcagcatgaccatgagcac
gtagacaagctgctaaacgccttccaatctctccagcagcaactcactgtccgagaagga
gacctggttatcgtgacagagttggttatgaagtgtctgattgactattcaaccaccagg
gtctccaggcccaacagtcagaggcttcgttggatcctctctggcagaacgcaacgcacg
ttaaaacacagctattacaagatcgcccatatgcccacaatccccgagtctgcctactga

KEGG   Salmo salar (Atlantic salmon): 106612230
Entry
106612230         CDS       T04363                                 

Gene name
CCNG1, Cyclin-G1
Definition
(RefSeq) cyclin-G1-like
  KO
K10145  cyclin G1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106612230 (CCNG1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 106612230
NCBI-ProteinID: XP_014068687
UniProt: B5X1T9
LinkDB
Position
ssa09
AA seq 299 aa
MLHTVTGPGALPFAVQLKALTDQEFRYQPKLSGLRIIETAHDNCLRMTARLREYEVKDLL
SLTRFFGFSAETFSLAVNLLDRFLAVMKIQPKHLSCVGLSCFYIAVKTTEEEKNVPMANE
LIRISQNRFTVSDMMRMEKIILQKLYWKVKAPTALHFLRLFYRRIQDTLEDDCKDIMNVE
RLEAQLKACHCSFTFSKVKPSLLALSLLALELQEQHDHEHIDKLLNAFQSLQQQLTVREG
DLVIVTELVMKCLIEYSTTKVSRPNGQRLRWILSGRTQRTLKHSYYKIAHMPTIPESAY
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcttcacacagtgactggaccaggggcgctgccctttgctgtgcagttgaaggctctg
actgaccaggagttcaggtaccagcccaagctgagcgggctgaggatcattgagacggcc
catgacaactgcctgaggatgaccgcccggctcagggagtatgaggtgaaggacctcctg
tctctgaccaggttctttggcttcagcgcagagaccttctccctggccgtcaacctgctg
gaccgcttcctcgctgtaatgaagatccagccaaagcacctgtcatgcgtgggcctgtcc
tgtttctacatcgctgtgaagaccacggaggaggagaagaatgtccccatggccaacgag
ctgatccggatcagccagaaccgcttcaccgtgtccgacatgatgaggatggagaagata
attctgcagaaactctactggaaggtcaaagcccccacagccctccacttcctcaggctg
ttctacagacggatacaggacacgcttgaagatgactgcaaggatatcatgaacgttgag
agactagaagcacagctgaaagcctgccattgctctttcactttctccaaagtcaagccc
tctctgcttgccctgtccttgttggccctggagcttcaggagcagcatgaccatgagcac
atagacaagctactgaacgccttccagtctctccagcagcaactcactgtccgagaagga
gacctggttatcgtgacagagttggttatgaagtgtctgattgagtattcaaccaccaag
gtctccaggcctaacggccagaggcttcgttggatcctctctggcagaacgcaacgcacg
ttgaaacacagctactacaagatcgcccatatgcccacaatccccgagtctgcctactga

DBGET integrated database retrieval system