KEGG   Salmo salar (Atlantic salmon): 100194994
Entry
100194994         CDS       T04363                                 

Gene name
rir2
Definition
(RefSeq) Ribonucleoside-diphosphate reductase subunit M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00230  Purine metabolism
sasa00240  Pyrimidine metabolism
sasa00480  Glutathione metabolism
sasa00983  Drug metabolism - other enzymes
sasa01100  Metabolic pathways
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100194994 (rir2)
   00240 Pyrimidine metabolism
    100194994 (rir2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100194994 (rir2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100194994 (rir2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100194994 (rir2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sasa03400]
    100194994 (rir2)
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     100194994 (rir2)
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    100194994 (rir2)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 100194994
NCBI-ProteinID: NP_001133495
UniProt: B5X215
LinkDB
Position
ssa15
AA seq 387 aa
MLTTRSPLSKKNTNAITTQMDNISLVDKENTPPSLNTTRILASRTARKIFADDSEVKPQN
VKKFNTEEPLLKENPRRFVIFPIKYHDIWQMYKKAEASFWTAEEVDLSKDTQHWDSLKDE
ERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDT
YIKDPKERDYLFNAIETLPCVKRKADWALNWIGNKNAGFGERVVAFAAVEGIFFSGSFAA
IFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSKETVTKLIRNAVEIEQE
FLTKALPVKLIGMNCDLMTQYIEFVADRLMLELGFDKIYRVENPFDFMENISLEGKTNFF
EKRVGEYQRMGVMSGTTDNAFRLDADF
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgcttacaacacgctcaccactctctaagaagaacaccaatgcaatcaccactcaaatg
gacaacatttcgctggtcgacaaagaaaacacgcctcctagcctgaacactacccgaatt
ctggcctcaagaaccgcgcgcaaaatctttgctgacgattctgaggttaagccccaaaat
gtcaagaaattcaacacagaagagccactcctgaaagaaaatccacgccggtttgtcatt
ttccccatcaagtaccatgacatctggcagatgtacaagaaggcagaagcttcattctgg
acagctgaggaggttgatctttccaaagacacgcagcactgggattctttgaaggatgag
gagagatacttcatctctcatgtactggctttctttgctgctagtgatggcattgtcaat
gagaacctggtcgagcgatttacacaggaagtccaggtgacggaagcaagatgcttctat
ggtttccaaatcgccatggagaacatccactctgagatgtacagcctgctcattgacacc
tacatcaaagaccccaaagagagggactacctcttcaatgccattgaaactctcccctgt
gtgaagaggaaggctgattgggccctgaactggatcggtaacaaaaatgctggatttggt
gagcgtgtggttgcatttgcggctgttgaggggatcttcttctctgggtcctttgctgcc
attttctggctgaagaagagggggctcatgcctggcctgaccttctcaaatgagctcatc
agcagagacgagggcctgcactgtgactttgcctgcctcatgttcaagcacctggtgcac
aagccctcaaaggagactgtcaccaagctcatcaggaacgcagtggagattgagcaggag
ttcctgacgaaggcccttccagtaaagctgattggcatgaactgtgacctgatgacccag
tacatagagtttgtggctgacaggctgatgctggagttgggctttgacaagatctacaga
gtggagaatccttttgacttcatggagaacatctcactggagggcaagactaacttcttt
gagaagcgagtaggggagtaccagagaatgggtgtgatgtctggcaccacagacaacgcc
ttccggctggatgctgacttctaa

KEGG   Salmo salar (Atlantic salmon): 106570792
Entry
106570792         CDS       T04363                                 

Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2 B-like
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00230  Purine metabolism
sasa00240  Pyrimidine metabolism
sasa00480  Glutathione metabolism
sasa00983  Drug metabolism - other enzymes
sasa01100  Metabolic pathways
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106570792
   00240 Pyrimidine metabolism
    106570792
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106570792
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    106570792
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106570792
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sasa03400]
    106570792
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     106570792
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    106570792
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 106570792
NCBI-ProteinID: XP_013998801
UniProt: A0A1S3M770
LinkDB
Position
ssa14
AA seq 374 aa
MCLERLGADQTFRRDFTAGGLLVLEMDCSNLTNVESTDYQNRHKDADQQHSTEDEPLLRD
NPRRFVIFPIQYPDIWRMYKQAQASFWTVEEVDLSKDLTHWDNLKPDEKHFISHILAFFA
ASDGIVNENLVQRFSQEVQLPEARSFYGFQILIENVHSEMYGMLINTYIRDSEEREHLFN
AIQTMPCVRRKADWAIQWISDTKSTFGERIVAFAAVEGIFFSGSFAAIYWLKKRGLMPGL
TYSNELISRDEGLHCNFACLLYSYIVKKPSEDRVKDIITKAVSIEQEFLTEALPVDLIGI
NGVLMKQYIEFVADRLLQDLGLAKVYLTENPFDFMESISLEGKTNFFEKRVAEYQRYGVM
SNSMNCDFTLDADF
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtgtttagaaaggctgggagcagaccagaccttcaggagagacttcactgctggaggg
ctgcttgttctagaaatggactgctcaaatctaacgaatgtagagtccacggattaccag
aacagacataaagacgcagaccagcagcacagcacagaggatgagcctttgcttcgagac
aaccccaggcgttttgtcatctttccaatccagtacccggacatctggaggatgtacaaa
caggcccaggcctcgttctggacagtggaagaggtggatctatctaaggacctgacacac
tgggacaacttgaagcctgatgagaaacacttcatctctcacatcttggctttctttgct
gccagcgacggcatcgtcaacgagaaccttgtccagaggtttagtcaggaggtgcagctt
ccagaggccagatcattctatgggttccagatcctcatagagaacgtccactctgagatg
tacggcatgctcatcaacacttacatcagggactctgaggagagggagcatttgttcaat
gccattcagactatgccgtgtgtgaggaggaaagcagactgggcgatccagtggatctct
gacaccaaatccacttttggggagcggatagtggcgttcgctgcagtggagggcatcttc
ttctcggggtcgtttgcagctatttattggttgaagaagagaggcctgatgcctgggctc
acctactccaacgagctcatcagcagagacgaggggctgcactgtaactttgcctgtctg
ttgtacagctacatagtgaagaaaccgtcagaggacagggtaaaggacattatcaccaaa
gctgtcagcattgagcaggagtttctgacagaggctttaccggtggatctgattgggatt
aatggtgtgctgatgaagcagtacattgagtttgtggcagaccgtttactccaagacctg
ggattggccaaggtctatctgacagaaaacccctttgacttcatggagtccatctcactg
gaagggaagacaaacttctttgagaagcgtgtggctgagtaccagaggtacggagtgatg
tcaaactccatgaactgtgacttcaccctggatgcagacttctag

KEGG   Salmo salar (Atlantic salmon): 106607664
Entry
106607664         CDS       T04363                                 

Gene name
rrm2
Definition
(RefSeq) ribonucleotide reductase regulatory subunit M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00230  Purine metabolism
sasa00240  Pyrimidine metabolism
sasa00480  Glutathione metabolism
sasa00983  Drug metabolism - other enzymes
sasa01100  Metabolic pathways
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106607664 (rrm2)
   00240 Pyrimidine metabolism
    106607664 (rrm2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106607664 (rrm2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    106607664 (rrm2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106607664 (rrm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sasa03400]
    106607664 (rrm2)
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     106607664 (rrm2)
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    106607664 (rrm2)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 106607664
NCBI-ProteinID: XP_014060331
UniProt: A0A1S3S7L8
LinkDB
Position
ssa06
AA seq 385 aa
MFATRSPLAKKNENAITTQMDNISLVDKENTPPSLNMTRILASKTARKIFADSESKDVAK
FNAEEEPLLKENPRRFVIFPIKYHDIWQMYKKAEASFWTAEEVDLSKDTQHWESLKEEER
YFISHILAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYI
KDPKERDYLFNAIETLPCVKRKADWALNWIGNKSAKFGERVVAFAAVEGIFFSGSFAAIF
WLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSKETVTNLIRNAVEIEQEFL
TKALPVKLIGMNCDLMTQYIEFVADRLMLELGFDKIYRVENPFDFMENISLEGKTNFFEK
RVGEYQRMGVMSGTTDNAFRLDADF
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgtttgcaactcgctcaccactcgccaagaaaaatgaaaacgctatcaccactcaaatg
gacaatatttcactcgttgacaaggaaaacacgcctcccagcctgaacatgacccggatt
ctggcctcgaaaaccgcgcgcaaaatctttgcagattctgagtctaaagatgtcgcgaaa
ttcaatgctgaagaagagccactcctgaaggaaaatccacgccggtttgtcattttccct
atcaagtatcatgacatctggcagatgtataagaaggcggaagcttctttctggactgca
gaggaggttgatctgtccaaagatacacaacactgggagtctctgaaggaagaggagaga
tacttcatctctcacatactggctttcttcgctgctagcgatggcattgtcaatgagaac
ctggtggagcgatttacacaggaagtccaggtgacagaagcaagatgcttctatggtttc
cagatcgccatggagaacatccactctgagatgtacagcctgctcattgacacctacatc
aaagaccccaaagagagggactacctcttcaatgccattgaaaccctcccttgtgtgaag
aggaaggctgattgggccctgaactggattggcaacaaaagtgctaaatttggtgagcgt
gtggttgcctttgcagctgttgaggggatcttcttttctggctcctttgctgccattttc
tggctaaagaagagggggctcatgccaggcctaaccttctccaacgagctcatcagcaga
gacgagggcctgcactgtgactttgcctgcctcatgttcaagcacctggtgaataagccc
tcaaaggagactgtcaccaatctgatcaggaatgcagtggagattgagcaggagttcctg
acaaaagccctgcctgtaaagctgattggtatgaactgtgacttgatgactcagtacatt
gagtttgttgctgacaggctgatgctggagctgggctttgacaagatctacagagtggag
aatccatttgacttcatggagaacatctcactggagggcaagactaacttctttgagaag
cgggtaggggagtaccagaggatgggtgtgatgtctggcactacagacaacgccttccgg
ctggatgctgacttctaa

DBGET integrated database retrieval system