KEGG   Salmo salar (Atlantic salmon): 100195274
Entry
100195274         CDS       T04363                                 

Gene name
smad4
Definition
(RefSeq) MAD homolog 4 (Drosophila)
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04310  Wnt signaling pathway
sasa04350  TGF-beta signaling pathway
sasa04371  Apelin signaling pathway
sasa04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100195274 (smad4)
   04350 TGF-beta signaling pathway
    100195274 (smad4)
   04371 Apelin signaling pathway
    100195274 (smad4)
   04068 FoxO signaling pathway
    100195274 (smad4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100195274 (smad4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100195274 (smad4)
SSDB
Motif
Pfam: MH2 MH1
Other DBs
NCBI-GeneID: 100195274
NCBI-ProteinID: NP_001133775
UniProt: B5X3J8
LinkDB
Position
ssa20
AA seq 507 aa
MSITNMPTSNDACLSIVHSLMCHRQGAESETFAKRAIESLVKKLKEKKDELDSLITAITT
NGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYTRLWRWPDLHKNELKHVKYCQFAFDLKC
DNVCVNPYHYDRVVSPGIDLSSLTLTSTATSLGLMVKDEYDFDGQPQLPTMDGGHSLQTI
QHPPSSRVGTPSEPFSTAGLLPLADARTTSAFPSISVGSGNATSTWTRNSSFMPNMPHHQ
NGHLQHHPPMPHPGHYWPVHNEHGFQPPISNHPAPDYWCSTAYFEMDVQVGETFKVPSTC
PVVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGIQLECKGEGDVWVRCHSDH
AVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLHQCHRQMQQQAATAQAAAAAQAASI
AGNISGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRTSIKETPCWI
EIHLHRALQLLDEVLHTMPIADPQSLD
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgtctatcaccaacatgcctacgagtaacgacgcttgcctgagcattgtacacagcttg
atgtgtcataggcaaggggcagagagtgagacctttgccaagcgagcaatagaaagtcta
gtgaaaaagctgaaggagaagaaggatgaactggactcccttatcacagccatcaccacc
aatggagctcaccccagcaagtgtgtcaccatccagcggactctagatggccgcctgcag
gtagcagggcgtaaagggttcccccacgtgatctacactcggttgtggagatggcccgat
ctgcataaaaatgaactgaagcatgtcaaatactgccagtttgcatttgacctgaagtgt
gacaatgtctgcgtgaacccctaccactacgaccgggtggtgtctccgggtattgaccta
tcaagcttgactcttaccagcacagctaccagcctgggactgatggttaaagatgagtac
gactttgacggccagccccagctgcccaccatggatgggggtcactccctccaaaccatc
cagcatcctccctccagccgagttgggaccccctcggagcccttcagcaccgctggcctg
ctgcccctcgctgatgcccgcaccacctccgccttccccagcatctctgttggatcagga
aatgccacctccacctggacgagaaacagcagcttcatgcccaacatgcctcaccatcag
aatgggcacctgcaacaccacccacccatgcctcatccagggcactactggcctgtgcac
aacgagcatggcttccagccccccatatccaaccatccagcgcccgattactggtgctcc
accgcttactttgagatggacgtgcaggtgggcgagaccttcaaggtgccctccacttgc
cctgtcgtgaccgtggacggctacgtggacccgtcgggtggagaccgcttctgtctgggc
cagctgagcaacgtgcaccggacagaggccattgaaagagccaggctccacatcgggaag
gggatccagctggagtgcaaaggtgaaggggacgtgtgggtccgttgccatagcgaccac
gcagtgtttgtgcagagctactacctggacagggaagccggccgcgcccccggcgatgcc
gtgcacaagatctaccccagcgcctacatcaaggtgtttgacctgcatcagtgccacagg
caaatgcagcagcaggcagcgacggcgcaggcggcagccgcagctcaggctgcctctatt
gctgggaacatctctgggccgggctcagtgggaggcatcgctcccgccatcagcctttcg
gcagcagccggcatcggcgtggacgacctgaggagactgtgcatcctgcgcatgagcttt
gtcaagggctggggtcctgactacccccggacgagcatcaaggagaccccctgctggatt
gagatccacctacaccgcgccctccagctactggacgaggtgctgcacaccatgcccatc
gctgacccccaatccttggactga

KEGG   Salmo salar (Atlantic salmon): 106563948
Entry
106563948         CDS       T04363                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04310  Wnt signaling pathway
sasa04350  TGF-beta signaling pathway
sasa04371  Apelin signaling pathway
sasa04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106563948
   04350 TGF-beta signaling pathway
    106563948
   04371 Apelin signaling pathway
    106563948
   04068 FoxO signaling pathway
    106563948
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106563948
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106563948
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 106563948
NCBI-ProteinID: XP_013985383
UniProt: A0A1S3L3L5
LinkDB
Position
ssa01
AA seq 550 aa
MSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITT
NGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQFAFDLKA
DNVCVNPYHYERVVSPGIDLSGLTLSSSGTLMVKDEYEFENQPSHSGADGHHQTIQHQPS
RPGGPQESFSSPALLPPPEGSSSASTSAFSSLAAGASTQSSSLLSGSHSSEGLRKLSSGP
GPAQGQSSQQNGYPLAQSATYHHSATSGWLRNGNFSPPVPHHQNGHLQHHQPMPNTPHYW
LSHNEIAFQPTISNHPAPDYWCSIAYFEMDVQVGETFKVPASCPTVTVDGYVDPSGGDRF
CLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAP
GDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAI
SLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHT
MPIADPQPLD
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgtcgatcacaaacacccccacaagcaatgacgcttgtctgagcatcgtgcacagcctg
atgtgccacagacagggtggagagagcgagaccttcgccaagcgagccattgagagcctt
gttaagaaactgaaggagaagaaagatgagctagattctttaatcacagccatcaccacc
aacggagctcaccccagcaagtgtgtcaccatacagcgcaccctggatggacgcctgcag
gttgcggggcgtaaaggcttcccccatgtgatctatgcaagactgtggcggtggcctgac
ctgcacaaaaatgaactgaagcatgtgaaatactgccagtttgcttttgacctcaaagct
gacaacgtgtgtgttaacccgtaccactacgagagggtggtatcaccagggattgacctt
tcaggactgactctttcaagctcaggcacactcatggtcaaagatgagtatgaatttgag
aaccagccatctcactccggtgcggacggccaccatcagaccatccagcaccaaccctcc
agaccagggggtccccaggagtcgttcagcagcccggccctgctccctccccctgagggc
agcagctcagcctccacctctgccttctccagcctcgctgctggagcttcaacccagtcc
agtagccttctgtcagggagccatagcagtgaaggtctgcggaagctatcctcagggcca
ggcccagcacagggacagagctcacagcagaatggctatcccctggcacagagcgccaca
taccatcacagtgccacctcaggctggctgagaaacgggaacttctcccccccagtgcct
caccaccagaatgggcacctgcagcaccaccaacccatgcccaacaccccacactactgg
ctctcgcacaatgagattgcattccagcccaccatctccaatcaccctgcccctgactac
tggtgttccattgcctactttgaaatggatgttcaggttggggagacgttcaaggttcca
gccagctgccccacggtgactgtggatgggtacgtggatccctcaggaggggaccgcttc
tgcctgggtcagctcagcaacgtccacaggacagaggcaatcgagagagccagacttcac
attggtaaaggggtgcagctggagtgtaaaggggaaggggacgtgtgggtgcgttgcctt
agcgatcatgcagtgtttgtgcagagttattacttggacagggaggcaggacgtgcccca
ggagatgcagtgcacaagatctaccccagcgcctacatcaaggtgtttgacctgcgccag
tgccacaggcagatgcagcagcaggcagccacagcacaggcggcagccgcagcacaggca
gcagcagtggctggaaacatccccgggcctggctctgtaggaggcatcgcccccgccatc
agtttgtctgcggcggcaggtataggagtggacgacctgcgcaggctgtgtatcctgagg
atgagctttgtgaagggctgggggcctgactacccccggcagagcatcaaggagactccg
tgctggattgagatccatctccaccgggccctgcagctactggatgaggtgctgcatacc
atgcccatcgctgacccccagcccctggactga

KEGG   Salmo salar (Atlantic salmon): 106568180
Entry
106568180         CDS       T04363                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04310  Wnt signaling pathway
sasa04350  TGF-beta signaling pathway
sasa04371  Apelin signaling pathway
sasa04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106568180
   04350 TGF-beta signaling pathway
    106568180
   04371 Apelin signaling pathway
    106568180
   04068 FoxO signaling pathway
    106568180
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106568180
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106568180
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 106568180
NCBI-ProteinID: XP_013993756
UniProt: A0A1S3LSA7
LinkDB
Position
ssa13
AA seq 548 aa
MSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITT
NGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLQKNELKHVKYCQFAFDLKA
DNVCVNPYHYERVVSPGIDLSGLTLSSSGTLMVKDEYEFENQPSHSGVDGHHQTIQHQPS
RPGGPQELFSSSALLPPPEGSSSASTSAFSSLAAGASTQSTSLLSGSHNSEGLRQLSSRP
GPGPSQGQSGFPLAQSATYHHNAASGWSRNGNFTPSVPHHQNGHLQHHQPMPHTPHYWMV
SDDIAFQPPISNHPAPDYWCSIAYFEMDVQVGETFKVPASCPTVTVDGYVDPSGGDRFCL
GQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGD
AVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISM
SAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMP
IADPQPLD
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgtcgatcacaaacacccccacaagcaacgacgcttgcttgagtatcgtacacagcctg
atgtgccacagacagggtggagagagcgagacattcgccaagcgagccatcgagagcctc
gtcaagaaactgaaggagaagaaagatgagctagattctctcatcacagccatcaccacc
aacggagctcaccccagcaagtgtgtcaccatacagcgcaccttggatggacggctgcag
gtcgcagggcgtaaaggcttcccccatgtgatctatgccagattgtggcggtggcctgac
ctgcaaaagaatgaactgaagcatgtgaaatactgccagtttgcctttgacctcaaagct
gacaacgtgtgtgttaacccataccactacgagagggtggtatcaccagggattgacctg
tcaggactgactctttcaagctcaggcacactcatggtcaaagatgagtatgaatttgag
aaccagccatctcactctggtgtggatggccaccaccagaccatccagcaccagccctcc
agaccagggggtccccaggagttgttcagcagctcggctctgctccctccccctgagggc
agcagctcagcctctacctctgccttctccagtctcgccgctggagcctcaacccagtcc
actagccttctgtcagggagccataacagtgaagggctgcggcagctatcctcaaggcca
ggcccagggccttcacaggggcagagcggcttccccctggcacagagtgccacataccat
cacaatgccgcctcaggctggtcgagaaatgggaacttcaccccctcagtgcctcaccac
cagaatgggcacctgcagcaccaccaacccatgccccacaccccacactactggatggtc
agcgatgacattgcattccagccccccatctcaaatcacccggcccctgactactggtgc
tccattgcctactttgagatggatgttcaggtgggggagacgttcaaggttccggccagc
tgccccacggtgacagtggacgggtacgtggatccctcaggaggggaccgcttctgcctg
ggacagctcagcaacgtccacaggacagaggccatcgagagagctagacttcacattggt
aaaggggtgcagctggagtgtaaaggggaaggtgacgtgtgggtgcgttgccttagcgat
catgcagtgtttgtgcagagttattacttggacagggaggcaggacgggcccctggagac
gcagtgcacaagatctaccccagcgcctatatcaaggtgtttgacctgcgtcagtgccac
aggcagatgcagcagcaggcagccacagcccaggcggcagccgcagcacaggcagcagca
gtggctggaaacatccccgggcctggctctgtgggaggcatcgcccccgccattagtatg
tctgcggctgcgggtataggagtggacgacttacgcaggctgtgtatcctgagaatgagc
tttgtgaagggctgggggcctgactacccccggcagagcatcaaggagacaccgtgctgg
attgagatccatctccaccgggccctgcagctactggatgaggtgctgcacaccatgccc
atcgctgacccccagcccctggactga

KEGG   Salmo salar (Atlantic salmon): 106569881
Entry
106569881         CDS       T04363                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04310  Wnt signaling pathway
sasa04350  TGF-beta signaling pathway
sasa04371  Apelin signaling pathway
sasa04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106569881
   04350 TGF-beta signaling pathway
    106569881
   04371 Apelin signaling pathway
    106569881
   04068 FoxO signaling pathway
    106569881
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106569881
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106569881
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 106569881
NCBI-ProteinID: XP_013997067
UniProt: A0A1S3M1I7
LinkDB
Position
ssa14
AA seq 600 aa
MNLERICADSIMSVNAPSSNDACLSIVHSLMCHRQGGENEGFAKRAIESLVKKLKEKKDE
LDSLITAITTNGVHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVK
FCQYAFDLKYDNVCVNPYHYERVVSPGIVGLSLQNTALSLSPLGPPGRLIKEEYIHDCIQ
MDMPLGMSPSDHPHPGALKLPPPDHYGQPLPPLQLPPEPQCAPPPITLYPNMPLSPTVSG
SMLPLQGGHSEGLLQIASPQGQVMTPITPTPPPSTPTHGLPHGPPQTPQPPQLPSGQNGY
NSSKHTQTQAAFHTTWTGSSTASYTPVGPQQQNGRGHQQPPLHHPTHFWSQHHGSASFPP
PVSNHPGPEFWCSISYFEMDVQVGEMFKVPASCPVVTVDGYVDPSGGDRFCLGQLSNVHR
TDSSERARLHIGKGVQLECRGEGDVWMRCMSDHAVFVQSYYLDREAGRAPGDAVHKIYPG
AYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAVSLSAAAGIGV
DDLRRLCILRLSFVKGWGPDYPRQSIKHTPCWVEVHLHRALQLLDEVLHTMPLADPGPAN
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgaatttggagagaatttgtgcagacagtatcatgtcggtgaacgcccccagcagcaat
gacgcctgcctgagcatcgtgcacagcctcatgtgccaccggcagggcggcgagaatgag
ggcttcgccaagcgcgccatcgagagcctggtgaagaagctgaaggagaagaaggacgag
ctggactcgctcatcaccgccatcaccaccaacggagtgcaccccagcaagtgtgttacc
atccagaggaccctagacggacgcctgcaagttgcagggaggaaaggcttcccccatgtg
atttacgctcgactatggcgctggccagacctgcacaagaatgagctaaagcacgtgaag
ttctgccagtacgctttcgacctcaaatatgacaatgtgtgtgtcaacccctaccactac
gagagagtggtttctcccggcattgttggtctcagtcttcaaaatacagccctctccctc
tctcctctaggcccccctgggaggctgatcaaagaggagtacattcatgactgtatccag
atggatatgccgctaggcatgtccccgtcggaccacccccacccaggggcgctcaagcta
ccgcctcccgaccactacggccagcccctcccgcctctgcagctcccgccggaaccgcag
tgcgcccctccgcccatcaccctctatcccaacatgcccctctcgcccacagtgtccggc
tctatgctgcctctccagggaggtcacagtgaagggctcctacagatcgcctctcctcag
ggtcaggtcatgacccctataacccccacgccgcccccctccaccccaacacacgggctg
ccacacgggccaccacagacccctcagccaccccagctcccgtctggtcagaatggatac
aacagctccaaacacacacagacacaggctgcgttccacacaacttggacaggcagcagc
acagcctcctacactcctgtaggaccccaacaacagaatgggcgtggccaccaacagcct
cctctccaccatccaacccacttctggtctcagcatcatggctcggcttcatttcctccc
cctgtgtccaatcatccaggaccagagttctggtgctccatctcctactttgagatggat
gtccaggtgggggagatgttcaaggtgccggccagctgcccggtggtaacggtggacggc
tacgtggacccctcagggggcgaccgcttctgtctgggccagctcagcaacgtccaccgc
accgactccagcgagagagccaggttgcacataggtaaaggagtgcagctggagtgtcgt
ggcgagggagatgtgtggatgcgctgtatgagcgaccacgccgtgttcgtgcagagctac
tacctggaccgagaggcaggcagagcaccaggcgacgcagtacacaagatctaccccggc
gcctacatcaaggtgtttgacctgagacagtgtcacaggcagatgcagcagcaggcagct
acagcgcaggcagcagcagcagctcaggctgccgccgtggccggcaacatccccgggcca
ggcagtgttggaggcattgcccctgcagtcagtctttctgcagcagcagggataggtgtg
gatgatctccggaggctgtgtatcctgcggctgagctttgtgaagggctgggggcccgac
tacccccggcagagcatcaaacataccccctgttgggtggaggtacacctgcaccgggct
ctgcagctgctggacgaggtactacacaccatgcccttggccgacccaggacccgctaac
tga

KEGG   Salmo salar (Atlantic salmon): 106580167
Entry
106580167         CDS       T04363                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04310  Wnt signaling pathway
sasa04350  TGF-beta signaling pathway
sasa04371  Apelin signaling pathway
sasa04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106580167
   04350 TGF-beta signaling pathway
    106580167
   04371 Apelin signaling pathway
    106580167
   04068 FoxO signaling pathway
    106580167
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106580167
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106580167
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 106580167
NCBI-ProteinID: XP_014016404
UniProt: A0A1S3NLW4
LinkDB
Position
ssa02
AA seq 565 aa
MSVNPPNSNDACLSIVHSLMCHRQGGENEGFAKRAIESLVKKLKEKKDELDSLITAITTN
GVHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKFCQFAFDLKYD
NVCVNPYHYERVVSPGIVGLSIQNAGPPGRLIKEEYIHDCYEMDLPSRMPPQPEHYNQPL
PPLQMPPELPRAPSSVNLYPSMPLSPPVSSSMMGPMSGGHGEGLLQIASPQIQGMPQTPP
PTTPTHGPPPQPPTPHSQSDYSSSSKHTQTQSSYHTTWTGTSTASYTPVGPQQNGRSHQQ
PPLHHPNHFWSQQHHSAPAFPQPVSNHPGPEFWCSISYFEMDIQVGEMFKVLANCPVVTV
DGYVDPSGGDRFCLGQLSNVHRTDASERARLHIGKGVQLECRGEGDVWMRCLSDHAVFVQ
SYYLDREAGRAPGDAVHKIYPGAYMKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIP
GPGSVGGIAPAVSLSAAAGIGVDDLRRLCILRLSFVKGWGPDYPRQSIKHTPCWVEVHLH
RALQLLDEVLHTMPLADLGGHGHVN
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgtcagtgaacccccccaacagcaacgatgcctgcctgagcatcgtgcacagcctcatg
tgccaccgacagggcggtgagaatgagggctttgccaagcgtgccatagagagcctggta
aagaagctgaaggagaagaaggatgagctggactcgctcatcaccgccatcaccaccaac
ggagttcaccccagcaagtgtgtcaccatccaaaggacgcttgatggacgcctgcaggta
gctgggaggaaagggttcccccatgtgatctacgctaggctctggcgctggccagacctc
cacaagaatgaactgaagcatgtcaagttctgccagttcgcctttgacctcaagtatgac
aacgtgtgtgtcaacccctaccactacgagagagtggtatcgccaggcattgttggtctc
agcattcaaaatgcaggtcctccaggtcggctgatcaaagaggagtacattcatgactgt
tatgagatggacctcccctccaggatgcccccccagcccgagcactacaaccagcccctc
ccccctctgcagatgccccccgagctgccccgcgccccatcctccgtcaacctctacccc
agcatgcccctctctccgccagtgagcagctccatgatggggcccatgtctgggggccac
ggcgagggcctgcttcagatcgcctctccccagatccagggcatgccccagacgccgccc
cccaccacccccacacacggaccacccccccagccccctacccctcacagccagagtgac
tacagcagcagctccaaacacacacagacacagagctcctatcacacgacctggacaggc
accagcacggcctcctatactcctgtaggaccccagcagaatgggcgtagccaccagcaa
ccaccactgcaccaccccaaccatttctggtctcagcaacatcacagcgcacccgccttt
cctcagccagtctccaaccatccaggtccagagttctggtgctccatctcctactttgag
atggacatccaggttggggagatgttcaaggtcctggctaactgccccgtggtgacagtg
gacggatacgtggacccctcggggggtgaccgcttctgtctgggccagctcagcaacgtg
caccgcaccgacgccagcgagagagccaggttgcacattgggaagggggtgcagttggag
tgtcgtggtgagggggatgtgtggatgcgttgccttagcgaccatgcagtgttcgtacag
agctactacctggaccgggaggcggggcgagccccgggagacgcagttcacaagatctac
cctggggcctacatgaaggtgtttgacctgcgtcagtgccacaggcagatgcagcagcag
gcagccacggcccaggctgcagcagcagcacaggctgcagcagtggcaggcaacatccca
gggcctggcagtgtggggggaatcgccccggcagtcagtctgtcggcagcagccgggata
ggtgtggacgacctgcggcggctgtgtatcctgcggctcagctttgtgaagggctggggg
cccgactacccccggcagagcatcaagcacaccccctgctgggtggaggtccacctgcac
cgtgccctgcagctgctggatgaggtgctgcacactatgcctctggctgacctaggagga
catggacatgtcaactaa

KEGG   Salmo salar (Atlantic salmon): 106585826
Entry
106585826         CDS       T04363                                 

Gene name
smad4
Definition
(RefSeq) SMAD family member 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04310  Wnt signaling pathway
sasa04350  TGF-beta signaling pathway
sasa04371  Apelin signaling pathway
sasa04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106585826 (smad4)
   04350 TGF-beta signaling pathway
    106585826 (smad4)
   04371 Apelin signaling pathway
    106585826 (smad4)
   04068 FoxO signaling pathway
    106585826 (smad4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106585826 (smad4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106585826 (smad4)
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 106585826
NCBI-ProteinID: XP_014027972
UniProt: A0A1S3PK00
LinkDB
Position
ssa24
AA seq 509 aa
MSITNTPSSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITT
NGAHPSKCVTIGRTLDGRLQVAGRKGFPHVIYTRLWRWPDLHKNELKHVKYCQFAFDLKC
DSVCVNPYHYDRVVSPGIDLSSLQLTSSGPSLGLMVKDEYDFDGQAPLPTMEGGHSLQTI
QHPPSSRGGPPSEPFGTPGLLSPSDASTASTSAFPSISVGSGNATSTWTRNSSFTPNMPH
HQNGHLQHHPPMPPPGHYWPVHNELGFQPPISNHPAPDYWCSIAYFEMDVQVGETFKVPS
TGPVVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGIQLEGKGEGDVWVRCLS
DHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAA
AVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRTSIKETPC
WIEIHLHRALQLLDEVLHTMPIGDPQPLD
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgtctatcaccaacacgccttcgagtaatgatgcttgcctgagcattgtacacagcttg
atgtgtcataggcaagggggagagagcgagacctttgccaagcgggcaatagaaagtctg
gtgaaaaagctgaaggagaagaaggatgaactggactccctaatcacagccatcaccacc
aatggagctcatcccagcaagtgtgtcaccattgggcggactctggatggccgtctgcag
gtggcaggtcggaaagggtttccccacgtgatctacactcggttgtggagatggcctgat
ctgcataaaaatgaactgaagcatgtgaaatattgccagtttgcgtttgacctgaagtgt
gacagcgtttgcgtgaacccataccactacgaccgggtggtgtctccaggcattgatcta
tcaagtttgcaacttaccagctcaggtccaagcctgggactgatggttaaagatgagtac
gactttgatggccaggccccactgcccaccatggaagggggtcactccctccagaccatt
cagcaccctccctctagccgaggtgggcccccctcggagcccttcggcacccctggcctg
ctgtccccctctgatgccagcaccgcctccacctccgccttccccagcatctctgtcgga
tcaggaaatgccacctccacctggactagaaatagcagcttcacgcccaacatgcctcac
catcagaatgggcacctgcaacaccacccacccatgcctcctccaggacattactggccc
gtacacaacgagcttggcttccagccacccatatccaaccatccagcgcctgactactgg
tgttccatcgcctactttgagatggacgtgcaggtgggtgagaccttcaaggtgccctcc
actggccccgtcgtgacggtggatggctatgtggacccgtctggcggagaccgcttctgc
ctaggccagctgagcaacgtgcaccggaccgaggccatcgaaagagccaggctccacatc
ggtaaggggatccagctggagggtaaaggtgaaggggacgtgtgggttcgttgcctcagt
gaccacgccgtgttcgtgcagagctactacctggaccgggaagccggccgcgcccctggc
gacgccgtgcacaagatctaccccagcgcctacatcaaggtgtttgacctgcgtcagtgc
cacaggcagatgcagcagcaggcagcgacggcccaggcggcagccgcggctcaggcagcc
gccgtggccgggaatatccctgggccgggctctgtgggaggcatcgctcccgccatcagc
ctttcagctgctgccggcatcggagtggacgacctgaggagactgtgcatcctgcgcatg
agcttcgtcaagggctggggtcccgactacccccggacgagcatcaaggagaccccctgc
tggatcgagatccacctacaccgggccctccagctactggacgaggtgctgcacaccatg
ccaatcggtgacccccagcccttggactga

KEGG   Salmo salar (Atlantic salmon): 106588319
Entry
106588319         CDS       T04363                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04310  Wnt signaling pathway
sasa04350  TGF-beta signaling pathway
sasa04371  Apelin signaling pathway
sasa04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106588319
   04350 TGF-beta signaling pathway
    106588319
   04371 Apelin signaling pathway
    106588319
   04068 FoxO signaling pathway
    106588319
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106588319
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106588319
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 106588319
NCBI-ProteinID: XP_014032645
UniProt: A0A1S3PY63
LinkDB
Position
ssa27
AA seq 593 aa
MSVNAPTSNDACLSIVHSLMCHRQGGENEGFAKRAIESLVKKLKEKKDELDSLITAITTN
GVHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKFCQYAFDLKYD
NVCVNPYHYERVVSPGIVGLSLQNTTLSPLAPPGRLIKEEYIHDCIQMDMPPGMSPSDHP
HPHPGALKLQPPDHYGQPLPPLQLPPEPQRAPPPITLYPNMPLSPTVSGSMLPLQGGHSE
GLLQIASPQGQVMTPMTPTPPPSTPTHGLPHGPPQNPQPPQPGQNGYNSSKHTQLQAAFH
TTWTGSSTASYTPVGPQQQNGRGHQQPPLHHPTSFCKLGSYRSQHHGSASFPPPVSNHPG
PEFWCSISYFEMDVQVGEMFKVPASCPVVTVDGYVDPSGGDRFCLGQLSNVHRTDASERA
RLHIGKGVQLECRGEGDVWMRCMSDHAVFVQSYYLDREAGRAPGDAVHKIYPGAYIKVFD
LRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAVSLSAAAGIGVDDLRRLC
ILRLSFVKGWGPDYPRQSIKHTPCWVEVHLHRALQLLDEVLHTMPLADPGPAN
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgtcggtaaacgcccccaccagcaatgacgcctgcctgagcatcgtgcacagcctcatg
tgccaccggcagggtggcgagaatgagggtttcgccaagcgtgccatcgagagcctggtg
aagaagctcaaggagaagaaggacgagctggactcgctcatcaccgccatcaccaccaac
ggtgtgcaccccagcaagtgtgtcaccatccagaggaccctggacggacgcctgcaggtt
gcagggaggaaaggcttcccccatgtgatctacgctcgattatggcgctggccagaccta
cacaagaatgagctaaagcacgtcaagttctgccaatacgccttcgacctcaaatatgac
aatgtgtgtgtcaacccctaccactatgagagagtggtttcgcccggcattgttggtctc
agtctccaaaatacaaccctctctcctctagccccccctgggaggctgatcaaggaggag
tacattcatgactgtatccagatggatatgccaccaggcatgtccccgtcggaccaccct
cacccccacccaggggcgctcaagctacagcctccggaccactacggccagcccctcccg
cctctgcagctcccgcctgaaccgcagcgggcccctccgcccatcaccctctaccccaac
atgcccctctcgcccacagtgtccggctctatgctgcctctccagggaggtcacagtgag
gggctcctacagatagcctctcctcagggtcaggtcatgacacctatgacccccacgccg
cccccctccaccccaacacacgggctgccacacgggccaccacagaacccccagccaccc
cagcctggtcagaatggatacaacagctccaaacacacacagttacaggctgcgttccac
acaacttggacaggtagtagcacagcctcctacactcctgtgggaccccaacaacagaat
gggcgtggccaccaacagcctcctctccaccatccaaccagcttctgtaagttaggcagt
tacaggtctcagcatcatggctcagcctcatttcctccccctgtgtccaatcatccaggg
ccagagttctggtgctccatctcctactttgaaatggatgtccaggtgggggagatgttc
aaggtgccggctagctgcccggtggtgacggtggacggctacgtggacccctcagggggt
gaccgcttctgtttgggccagctcagcaacgtccaccgcaccgacgccagcgagagagcc
aggttgcacataggtaaaggagtgcagctggagtgtcgtggcgagggagacgtgtggatg
cgctgtatgagcgaccacgccgtgttcgtgcagagctactacttggatcgagaggcaggc
agagcgccaggcgacgcagtacacaagatctaccccggcgcctacatcaaggtgtttgac
ctgagacagtgtcacaggcaaatgcagcagcaggcagctacagcgcaggcagcggcagca
gctcaggctgccgccgtggcaggcaacatccctgggccaggcagcgttggaggcatagcc
cctgcagtcagtctttctgcagcagcagggataggtgtggacgaccttcggaggctgtgt
atcctgcggctgagctttgtgaagggctgggggcccgactacccccggcagagcatcaaa
cataccccctgttgggtggaggtacacctgcaccgggctctgcagctgctggacgaggta
ctacacaccatgcccttggccgacccaggacccgctaactga

KEGG   Salmo salar (Atlantic salmon): 106605446
Entry
106605446         CDS       T04363                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04310  Wnt signaling pathway
sasa04350  TGF-beta signaling pathway
sasa04371  Apelin signaling pathway
sasa04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106605446 (SMAD4)
   04350 TGF-beta signaling pathway
    106605446 (SMAD4)
   04371 Apelin signaling pathway
    106605446 (SMAD4)
   04068 FoxO signaling pathway
    106605446 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106605446 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106605446 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 106605446
NCBI-ProteinID: XP_014056588
UniProt: A0A1S3RWE4
LinkDB
Position
ssa05
AA seq 581 aa
MSVNPPNSNDACLSIVHSLMCHRQGGENEGFAKRAIESLVKKLKEKKDELDSLITAITTN
GVHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKFCQFAFDLKYD
NVCVNPYHYERVVSPGIVGLSIQNAGEEENTIFSIIKHHQNGHPGRLIKEEYIHDCFEMD
LPSRMPPQPERYNQPLPPLQMPPEPPRAPSSVNLYPSMPLSPPVSSSMMGPMSGGHGEGL
LQIASPQSQGMPQTPPPTTPTHGPPPQPPTPHSQSDYSSSSKHTQTQSSYHTTWTGTSTA
SYTPVGAQQNGRGHQQPPLHHPNHFWSQQHHSAPAFPQPVSNHPGPEFWCSISYFEMDIQ
VGEMFKVLANCPVVTVDGYVDPSGGDRFCLGQLSNVHRTDASERARLHIGKGVQLECRGE
GDVWMRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPGAYMKVFDLRQCHRQMQQQAATA
QAAAAAQAAAVAGNIPGPGSVGGIAPAVSLSAAAGIGVDDLRRLCILRLSFVKGWGPDYP
RQSIKHTPCWVEVHLHRALQLLDEVLHTMPLADLGGHGHVN
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgtcagtgaacccccccaacagcaacgatgcctgcctgagcatcgtgcacagcctcatg
tgccaccgacagggcggtgagaacgagggctttgccaagcgtgccatagagagcctggta
aagaagctgaaggagaagaaggatgagctggactcgctcatcaccgccatcaccaccaac
ggagttcaccccagcaagtgtgtcaccatccagaggacgcttgatggacgcctgcaggta
gctgggaggaaagggttcccccatgtgatctatgctaggctctggcgctggccagacctc
cacaagaatgaactgaagcacgtcaagttctgccagttcgcctttgacctcaagtatgac
aacgtgtgtgtcaacccctaccactacgagcgagtggtatcgccaggcatcgttggtctc
agcattcaaaatgcaggtgaggaggaaaacactattttcagcatcatcaaacatcatcaa
aatggtcatccaggtcggctgatcaaagaggagtacatccatgactgttttgagatggac
ctcccctccaggatgcccccccagcccgagcgctacaaccagcccctccccccactgcag
atgccccccgagccgccccgcgccccatcctctgtcaacctttaccccagcatgcccctc
tctccgccagtgagcagctccatgatggggcccatgtctgggggccacggcgagggcctg
ctccagatcgcctctccccagagccagggcatgccccagacgccgccccccaccaccccc
acacacgggccacccccccagccccctacccctcacagccagagtgactacagcagcagc
tccaaacacacacagacacagagctcctatcacacgacctggacaggcaccagcacggcc
tcctatacccctgtaggagcccagcagaatgggcgtggccaccagcaaccaccactgcac
caccccaaccacttctggtctcagcaacatcacagcgcacccgcctttcctcagccagtc
tccaaccatccaggtccagagttctggtgctccatctcctactttgagatggacatccag
gttggggagatgttcaaggtcctggctaactgccccgtggtgacagtggacggatacgtg
gacccctcaggtggcgaccgcttctgtctgggccagctcagcaacgtgcaccgcaccgac
gccagcgagagagccaggttgcacattgggaagggggtgcagttggagtgtcgtggtgag
ggggatgtgtggatgcgttgccttagcgaccatgcagtgttcgtacagagctactacctg
gaccgggaggcggggcgagccccgggagacgcagttcacaagatctaccctggggcctac
atgaaggtgtttgacctgcgtcagtgccacaggcagatgcagcagcaggcagccactgcc
caggctgcagcagcagcacaggctgcagcagtggcaggcaacatcccagggcctggcagt
gtggggggaatcgccccggcagtcagtctgtcggcggcagccgggataggtgtggacgac
ctgcggcggctgtgtatcctgcggctcagctttgtgaagggctgggggcccgactacccc
cggcagagcatcaagcacaccccctgctgggtggaggtccacctgcaccgcgccctgcag
ctgctggatgaggtgctgcacaccatgcctctggctgacctaggaggtcacggacatgtc
aactaa

DBGET integrated database retrieval system